KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_03480Help
Entry
BJAB07104_03480   CDS       T02726                                 

Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
abj  Acinetobacter baumannii BJAB07104
Pathway
abj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abj01100  Metabolic pathways
abj01110  Biosynthesis of secondary metabolites
abj01130  Biosynthesis of antibiotics
abj01230  Biosynthesis of amino acids
Module
abj_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:abj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BJAB07104_03480
Enzymes [BR:abj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BJAB07104_03480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 AAA_5 TsaE Cytidylate_kin AAA_22 AAA AAA_16 Cytidylate_kin2 AAA_28 Mg_chelatase dNK CHDNT ABC_tran RNA_helicase Ploopntkinase3 AAA_30
Motif
Other DBs
NCBI-ProteinID: AGQ15846
LinkDB All DBs
Structure
PDB: 

Position
complement(3656982..3657551)
Genome map
AA seq 189 aa AA seqDB search
MKAIEIGGALPSKAFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGAT
IPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAPNREFLKQRGIVVYLYTP
VELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKIL
QLILSNKLK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattgaaataggtggcgccttgccaagcaaagcgtttgaaaccctaccaaat
atttatttggtagggcccatgggggcaggaaaaacaaccgttggacgtcatttagcagaa
ctattagggcgtgaatttttagatagtgatcatgaaattgagcgcaagacaggggccact
attccctggatttttgaaaaagaaggagaagtcggcttccgtacgcgtgaaactgtcgtt
ttaaatgagcttacttcacgtaaggcattagtgcttgccacaggtggcggtgctattact
caggcgcctaatcgggagtttttaaagcaacgtggaatcgttgtttatctatatactcct
gtcgaattacaactacaaagaacctatcgcgataaaaatagacctttattacaagttgaa
aaccctgaacaaaaattgcgggatttattaaagatcagagatcctctgtatcgtgaagtt
gcacactatacgattgaaacgaatcaaggtgctgcacgtgatcttgcccaaaagattttg
caacttattctatcgaacaagttaaaatag

DBGET integrated database retrieval system