KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_03629Help
Entry
BJAB07104_03629   CDS       T02726                                 

Definition
(GenBank) UDP-N-acetylmuramate-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
abj  Acinetobacter baumannii BJAB07104
Pathway
abj00471  D-Glutamine and D-glutamate metabolism
abj00550  Peptidoglycan biosynthesis
abj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BJAB07104_03629
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJAB07104_03629
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abj01011]
    BJAB07104_03629
Enzymes [BR:abj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     BJAB07104_03629
Peptidoglycan biosynthesis and degradation proteins [BR:abj01011]
 Precursor biosynthesis
  Amino acid ligase
   BJAB07104_03629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C BRCT UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-ProteinID: AGQ15995
LinkDB All DBs
Structure
PDB: 

Position
complement(3815054..3816502)
Genome map
AA seq 482 aa AA seqDB search
MSPTTAANQAKKLIKVPEMRRIKHIHFVGIGGAGMCGIAEVLANQGYKISGSDIKASKTT
QQLEENGIKVYIGHEAENIKNANVLVVSTAIDPENPEVKAAIEQRVPIVRRAEMLGELMR
YRHGIAVAGTHGKTTTTSLLTTMLAEENLDPTYVIGGLLNSTGVNAALGESRFIVAEADE
SDASFLYLQPMAAIVTNIDADHMDTYEGSFDKLKDTFVQFLHNLPFYGLAVVCGDDANIR
EILPRVGRPVITYGFNEDNDIRAIDVEQDGMRSHFTVLRKGREPLRLTINQPGLHNVLNA
LAAIGVATDEGVSDEAISRALKGFSGVGRRFQVQGEFELGEGNVKLVDDYGHHPKEVEAT
IKAARQSHPDRRLVMLFQPHRYSRTRDCFDDFIEVLSQVDQLLLLEVYPAGEKPIVGADS
RTLARSIRLRGQVEPILIDPVEGNLQNIMQSVLQPNDLLLTQGAGNVGAISVELAQHHLY
VK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaacaacagctgcgaaccaagcaaaaaaactgattaaagtgcctgaaatgcgc
cgtatcaaacacattcattttgtgggaattggcggtgcaggtatgtgtggtattgctgag
gtgttagctaaccaaggatataaaatttccggttcagatattaaggcatcaaaaaccaca
caacaattagaagaaaatggcattaaggtctatatcggacacgaagcagaaaatattaaa
aatgcaaatgtgcttgtcgtgtcaacagcaattgacccggaaaatccggaagttaaagct
gccattgaacaacgtgttccgattgtacgtcgtgcagaaatgctcggtgaacttatgcgt
taccgtcatggtattgctgtggcaggtacacatggtaaaactacaaccacaagtcttttg
acgacaatgttggcggaagaaaacctcgacccaacttacgtgatcggtggtttacttaac
agtacaggtgtaaatgcagcgcttggtgaaagccgctttattgttgctgaagctgacgaa
tcggacgcatctttcctttatttacaaccaatggcagcgattgtaaccaatatcgatgct
gaccatatggacacttatgaaggcagtttcgataaattaaaagataccttcgtacagttc
cttcataacttaccattctacggcttggctgtggtttgtggcgatgatgcgaacatccgt
gagattttgccacgtgtaggccgtccggttattacttatggttttaatgaagataatgac
atccgtgctatcgatgtagagcaagatggtatgcgttcgcactttactgtattacgtaaa
ggacgtgagccgttacgtctaaccattaatcaaccgggtttacataacgttttaaatgct
ttggctgcaattggtgttgcaactgatgaaggcgtttcggatgaagcaattagccgtgca
ttaaaaggttttagtggtgttggacgtcgcttccaagtacaaggtgaatttgagcttggt
gaagggaatgtaaaattagtcgatgactatggacaccatcctaaagaagtagaagctacg
attaaagctgctcgtcagagccatcctgatcgtcgtttagttatgcttttccaaccacac
cgttactctcgtacacgtgattgttttgatgactttattgaagttttatctcaagtcgat
caattattattactagaagtttatccggctggggaaaaaccaattgttggcgcagatagc
cgtactttggcgcgtagtattcgcttgcgtggtcaggttgaaccgattttgattgatccg
gttgaaggtaatttgcaaaacatcatgcaaagtgtgttacaaccaaatgacttgttatta
acgcaaggtgcaggtaacgtgggagcaatttcagtagaacttgcacagcaccatttgtat
gtgaaataa

DBGET integrated database retrieval system