KEGG   Acinetobacter baumannii AbH12O-A2: LX00_01270Help
Entry
LX00_01270        CDS       T03374                                 

Definition
(GenBank) histidine kinase
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
abk  Acinetobacter baumannii AbH12O-A2
Pathway
abk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LX00_01270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:abk01001]
    LX00_01270
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:abk02022]
    LX00_01270
   02035 Bacterial motility proteins [BR:abk02035]
    LX00_01270
Enzymes [BR:abk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     LX00_01270
Protein kinases [BR:abk01001]
 Histidine kinases
  NtrC family
   LX00_01270
Two-component system [BR:abk02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   LX00_01270
Bacterial motility proteins [BR:abk02035]
 Pilus system
  Twitching motility proteins
   LX00_01270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS PAS_7 PAS_8 HATPase_c_3 HATPase_c_2 DUF4670 MLTR_LBD
Motif
Other DBs
NCBI-ProteinID: AIS05035
LinkDB All DBs
Position
complement(268502..270070)
Genome map
AA seq 522 aa AA seqDB search
MQFPLNSSLSHTIFRLGTWYGLYRLIIAVSLNIILVLTDAQTDNSLQQPALYSYTLLGYS
LLSLVQLLCFKFIATQATRQLILFFIVDIICLSLLTFSVGEPNLQLSLLYVIAIFTSAIL
LSARMSLLITLLAVIAVIYQRFVGSLFDYNNLNTIGNSALLAFLFFVVHGIGQIAVQRFK
LLEALTFHQSIELYQLQNINRYILEQIEEGYLVLDENYDIVVSNPAACSLLGIPPQFANE
KYPLAKWHADLFEILKFGDLKEGDRFIFESRLSAYSINIKVQHLLVPQQTLTLLILQDAQ
QINQQAQQLKLAALGQLSASIAHEIRNPLAAIVQANELLKDSDPEQQNTLRHMIGKQTKR
IDSIVQDTLGLARSERTHPIQIDVKHFIDTLLEEDLFDVKHSIQLKISDSSLKFLFDEKQ
LRQVMINLVRNALRHNAPDSPYITVNIHSQTNKIYIDVIDYGEGVSKRDISQLFKPFFST
EINGTGLGLYLSHSFCEANHAKLIYVEQKQGACFRIECPIIY
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttcccttaaattcatccttgtcccatacgatttttcgtttgggcacttggtat
ggcttataccgtcttattattgcggttagcctgaatattattttggttttgaccgatgcg
caaactgataacagtttgcagcaacctgccttatattcctacacactactcggctattcg
ctcttaagtcttgttcagctgttatgctttaaatttattgccactcaagccacgcgacag
cttattttattttttattgttgatattatttgtttgagtttactaactttttctgtgggt
gaaccaaatttacaactcagcttactctatgtaattgccatctttacctcggcgatttta
ctcagcgcaagaatgtctttgctgattacattgcttgcggttatcgctgttatttatcaa
agatttgtaggtagtctatttgactataacaatctaaatactattggtaatagcgctctc
ttagctttcttattttttgtggttcacggaattggccaaattgcagtgcagcgctttaaa
ttacttgaagcactcacctttcaccagtcaattgaactttatcaactccaaaatattaac
cgttatatcttagaacaaattgaagaaggctatttagttttagatgagaattacgacatc
gttgtcagtaatcctgcggcctgttcactcttgggtattccccctcaatttgccaatgaa
aaatatcctttagcaaagtggcatgccgatttatttgaaattttaaagtttggcgactta
aaagaaggtgaccgattcatttttgagtctcggctatcggcgtactccatcaacattaaa
gtgcaacatcttttggtcccacaacaaacgctaaccctgctcattttacaagatgcccaa
caaattaatcagcaagcacaacagcttaagcttgctgcgctagggcaactctcagcaagt
attgcacatgagatccgcaatcctctcgctgcaatcgtacaagcaaatgagttactgaaa
gatagcgatccagaacaacaaaatactttgcgtcatatgattggcaaacaaaccaaacgc
attgatagtattgttcaagatactttaggacttgctcgtagtgaaagaacacatcctatc
cagatcgatgtaaaacacttcatagatacattgctcgaagaagatttatttgacgttaaa
cattcaattcaacttaaaatttctgatagttctctaaaatttttatttgatgaaaaacaa
ttaagacaagtcatgatcaatctggtgagaaatgctttacggcataatgcccccgactca
ccgtacattacggtcaacatccattcacagacaaataaaatttatattgatgtgatcgat
tacggtgaaggtgtttcaaaacgtgatatatctcaactatttaaaccattttttagtacc
gaaattaatggaactggtttaggattatatttgtctcatagtttttgtgaggcgaaccat
gcaaagctcatctatgtagagcaaaaacaaggggcatgcttcagaatagaatgcccaata
atatattga

DBGET integrated database retrieval system