KEGG   Acinetobacter baumannii AbH12O-A2: LX00_08655
Entry
LX00_08655        CDS       T03374                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
abk  Acinetobacter baumannii AbH12O-A2
Pathway
abk00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:abk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LX00_08655
Enzymes [BR:abk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LX00_08655
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LX00_08655
    1.1.1.-  
     LX00_08655
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C FAD_binding_3 TrkA_N zf-RING_11
Other DBs
NCBI-ProteinID: AIS06442
UniProt: A0A4V3S0T4
LinkDB
Position
1818837..1819895
AA seq 352 aa
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGDTALVG
GAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNG
DGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYV
NDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaaagcagcgcgtttttatgacagaggtgatatccgtattgaagatattcctgaacca
gaagtcactcccggcactgtaggcattaaggtagcctggtgtggaatctgtggtacagat
ttgcacgaatttatggaaggaccaatttttattccaccttgtggacatccgcatcctatt
tcaggtgaatctgcgccaattaccatgggacatgaattttcaggtgtagtctatgccgta
ggtgaaggtgtggatgatattgaaattggtcagcatgtcgtcgtagagccttatattgtg
gccgatgatgtgccgactggaccgggtgataattatcatctttctaaaaatatgaacttc
attggtttaggcggtcgtggtggtggtttatcggaaaaaattgcagttaaacgccgttgg
gtgcatccaatttccaataaaattccgctagatcaggcagccttaattgaaccgttatcg
gtgggtcatcatgctttcgtacgtagtggtgcaaaagctggtgatactgcactggttggc
ggtgcaggtccaattggtttgttgctttcggcaattttaaaagctaaagggcttaaggtc
atcattaccgaactaagtgcaaaacgtaaagaaaaagccaaagagtcgggagtcgcagat
tatattttagacccgtcagaagttgatgttgtttctgaggtcatgaaaattactaatggc
gatggtgtcgacgtcgcgtttgaatgtagtagcgttaacaaggtattagataccttggtt
gcagcagtaaaaccgacaggcgttattgttattgtttcaatttggagccacccagcatca
attaatgtgcacagtgttgtaatgaaagagctcgatgtaagaggcacaattgcctacgta
aatgaccatcaagaaaccattaaactggtcgaagaaggtaaaataaatctggaacctttt
attacccagcgcattcaacttgatgatttgatttcacaaggttttgaaaccttaattcat
aacaatgaatcagccgttaagattattgtacatccataa

DBGET integrated database retrieval system