KEGG   Acinetobacter baumannii AbH12O-A2: LX00_12655Help
Entry
LX00_12655        CDS       T03374                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
abk  Acinetobacter baumannii AbH12O-A2
Brite
Enzymes [BR:abk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LX00_12655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIS07203
UniProt: V5VAU8
LinkDB All DBs
Position
2644316..2644942
Genome map
AA seq 208 aa AA seqDB search
MTTITLPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKA
TAGDASKAGIFNNAAQVWNHTFYWNSMKPNGGGKPTGAIAAKIDEAFGSYEKFAEEFTAA
ATTQFGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPK
YIATFLENLVNWDYANAKLAGQPAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttacctgcacttccatatggctatgatgatttagcgccacatatc
agtaaagaaactttagaataccatcacgacaaacatcacaatacctatgttgttaactta
aacaacttaatcaaaggtactgaccttgaaggtaaaactttagaagaaatcattaaagca
actgctggtgatgcatctaaagctggtattttcaacaatgctgctcaagtttggaaccac
actttctactggaacagcatgaagccaaacggtggtggtaagcctactggcgcaatcgct
gctaaaattgacgaagcttttggtagctacgaaaaatttgcagaagaatttactgctgct
gcaacaactcaattcggttcaggttgggcttggttagttgctgatgaagtaaacggtaaa
ctttctattactaaaacttctaatgcagacactccacttgcacatggtcaaattgctgta
ttaacaattgacgtatgggaacacgcttactacatcgatttccgcaacttacgtcctaaa
tacatcgcaactttcttagaaaaccttgtgaactgggactatgcaaatgcaaaacttgca
ggccaaccagctggtgtagagaaataa

DBGET integrated database retrieval system