KEGG   Acinetobacter baumannii AbH12O-A2: LX00_15220Help
Entry
LX00_15220        CDS       T03374                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
abk  Acinetobacter baumannii AbH12O-A2
Pathway
abk00970  Aminoacyl-tRNA biosynthesis
abk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LX00_15220
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:abk03029]
    LX00_15220
Enzymes [BR:abk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LX00_15220
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LX00_15220
Mitochondrial biogenesis [BR:abk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LX00_15220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AIS07683
UniProt: A0A0B9XG50
LinkDB All DBs
Position
3169258..3170736
Genome map
AA seq 492 aa AA seqDB search
MTDLHRLSIRELAEGLSQAKFSSRELTEHYLKRIAKIDPQVKSYVTVTPEQALREADAAD
AALKAGNATALTGIPLAHKDIFCTKGIKTTAGSKMLDNFISPYDATVVEKTKAAGLVTLG
KVNMDEFAMGSTSESSYVGATSNPWALDHVPGGSSGGSAAAVAADLAPFATGTDTGGSIR
QPASFCGLTGLKPTYGRVSRFGIIAYASSLDQAGPMARSAEDCAYLMNVIAGHDAKDSTS
VKKEVDDYVANLNNTSVKGLRIGLPKQYFNVAGLDADVKARVEESLKKLEEMGATLVEID
LNMTEAYVPTYYLIAPAEASSNLSRYDGVRYGYRCENPADLMDLYKRSRSEGFGPEVQRR
ILIGTYALSAGYYDAYYVKAQKVRRLIQQDFLKAFENVDVIAAPAAPTTAYKIGASLDPV
EMYLGDIYTIAVNLAGLPAINAPVGFDKDNLPVGLQLIGNYWSESQLLSIVHQYQQNTDW
HTKRAAIAEENA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttacatcgcttatcaattcgcgaacttgctgaaggcttaagccaagcgaag
ttttcatctcgcgaattgactgaacattatttaaaacgtattgctaaaattgacccgcaa
gttaagagttatgtgacggttactccggaacaggcacttcgcgaagccgatgctgccgat
gccgcattaaaagctggcaatgcaactgctttaacgggtattcctcttgcccacaaagac
atcttttgtaccaaaggtattaaaaccactgctggttcaaaaatgctcgataacttcatt
tcaccttacgatgcaaccgttgttgaaaaaactaaagcagctggtctggttactttaggt
aaagtaaacatggatgagtttgcgatgggctcaacttctgagagttcatatgtaggtgca
acgagtaacccttgggcacttgaccatgttcctggcggttcatctggtggttctgctgcg
gctgtagcagctgatttagcaccatttgctacaggtaccgatacaggtggctcaattcgc
caacctgcttctttctgtggtttaacaggcttaaaaccaacttatggtcgtgtatctcgt
ttcgggatcattgcttatgcatcctctttagaccaagcaggtccgatggctcgctctgct
gaagactgtgcttacctaatgaatgtaattgcaggtcacgatgctaaagactcaacttcg
gttaaaaaagaagtcgatgattacgttgcaaacctaaataacacatctgtaaaaggctta
cgcattggtcttcctaaacaatactttaacgttgcaggtttagatgcggacgtaaaagca
cgtgttgaagagtctttgaaaaagcttgaagaaatgggcgcaacgcttgttgaaatcgac
ctcaacatgactgaagcatatgtaccaacgtattacctcatcgcgccagcggaagcatct
tctaatttgtcacgttatgacggtgttcgctacggttaccgctgtgaaaacccagctgac
ttgatggatctttacaaacgttcgcgttcagaaggcttcggtccagaagttcaacgccgt
attttaattggtacatacgcgctttctgcgggttattacgatgcttactatgtaaaagca
caaaaagtacgtcgtttaattcaacaagacttcttaaaagcttttgaaaatgtagatgta
attgcagcacctgctgcaccaacaactgcctacaaaatcggtgcatctttagaccctgtt
gaaatgtacttaggcgatatctataccatcgcagtgaacttagcgggcttgccagcgatt
aatgctcctgttggttttgataaagacaacttaccagtaggtttacagttaatcggtaat
tactggtcagaatcacaattgttgtcgattgttcaccaataccaacaaaacactgactgg
cacaccaaacgtgcggcaattgctgaggagaatgcataa

DBGET integrated database retrieval system