KEGG   Acinetobacter baumannii AbH12O-A2: LX00_16285Help
Entry
LX00_16285        CDS       T03374                                 

Definition
(GenBank) membrane protein
  KO
K07058  membrane protein
Organism
abk  Acinetobacter baumannii AbH12O-A2
Brite
KEGG Orthology (KO) [BR:abk00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    LX00_16285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AIS07876
UniProt: V5V9S3
LinkDB All DBs
Position
3390980..3392227
Genome map
AA seq 415 aa AA seqDB search
MLERFLKKLPFYNKTWFQFILFVIKRFEADRCREQAGSLTYTTLFAVVPMLTVFLVIISS
IKALEPARQQLQHLIYSNFLPKSTIAFDKALNAFTEKSSNLTVIGVLFLFVTTVLMLTSI
ETVFNRIWRVKETRSGIVGFMRYWTIISLGPIILGSAFVISSTVASMNLLSNNFTGYQLD
GAFLLWLISFVLTILGFFILYWTIPNRTVPLYAAAIAACLSAALFETLKNLFSFVMSNFT
SYEIIYGAFAAVPIFLLWVFLSWNIVLLGVEVSFALTAFHSGKEQKRHPVLMLLDILELF
YKKQKLGESVSDKEALEILGRGEVGRWPAYVLLLEEQNLVKRTDKDEYVLVRNLSQVDFW
SFFTALPYPLPLRQDVSNVHDDDEWMEKIGPALVESNDYLAAKLSIPLSTIFEEK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacgttttttgaagaagcttcctttttataacaagacctggtttcaatttatt
ttattcgtaattaagcgttttgaagcggatcgttgccgtgaacaagccggctccctcacc
tatacgacactttttgccgttgtacctatgttaacggtatttttagttattatttcttca
attaaggcattggaacctgccagacaacagttacagcacttaatctacagtaattttttg
cctaaaagtacgattgcttttgataaagctcttaatgcttttaccgaaaagtccagtaat
ttaactgtaattggtgtgctattcctctttgtcacaacagttttaatgcttacttcaatt
gaaaccgtttttaaccgaatatggcgagtaaaagaaacccgtagcggtattgtaggcttt
atgcgttactggaccattatttcacttggtccaattattttaggcagtgcatttgttatt
tcatcaactgttgcttccatgaatttattgagcaataacttcacaggttatcaacttgat
ggcgcatttttactctggcttatttcttttgttctcacaattttaggtttttttatttta
tattggactattcccaaccgcacagttcccctatatgcagcagcaattgctgcatgctta
agtgctgcattatttgagacactcaaaaatttatttagctttgttatgtcaaatttcacc
agttatgaaatcatatatggtgcgtttgcagcagtacctattttcctattatgggtcttc
ttatcttggaatattgtattgcttggtgtcgaggtaagttttgctcttaccgcttttcat
tcaggcaaagagcaaaaaagacatccggttttaatgctactcgacattttggaattgttc
tataaaaagcaaaaacttggtgaaagcgtaagtgataaagaagcattagaaattttaggt
cgtggtgaagttggtcgttggcctgcttatgttctcttactagaagagcaaaatctagtt
aaacgtaccgataaagatgaatatgttttggtccgcaatttatctcaagtcgacttttgg
agcttcttcactgcactgccttatccattacctttacgtcaggatgtatcaaatgttcat
gatgatgacgaatggatggaaaaaattggtccagctttagtagagtctaatgattattta
gctgcaaagctctctattccactttcaacaatttttgaagagaaataa

DBGET integrated database retrieval system