KEGG   Arcobacter butzleri 7h1h: A7H1H_0139Help
Entry
A7H1H_0139        CDS       T02755                                 

Gene name
speE
Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
abl  Arcobacter butzleri 7h1h
Pathway
abl00270  Cysteine and methionine metabolism
abl00330  Arginine and proline metabolism
abl00410  beta-Alanine metabolism
abl00480  Glutathione metabolism
abl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A7H1H_0139 (speE)
   00330 Arginine and proline metabolism
    A7H1H_0139 (speE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A7H1H_0139 (speE)
   00480 Glutathione metabolism
    A7H1H_0139 (speE)
Enzymes [BR:abl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     A7H1H_0139 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth
Motif
Other DBs
NCBI-ProteinID: AGR76476
UniProt: S5P7Q5
LinkDB All DBs
Position
147888..148436
Genome map
AA seq 182 aa AA seqDB search
MKYNNAFNEMMVHIPLCTHKEASKVLIIGTINDNLKIEASKHNKISNIEFGDLAFLKSHN
EKNVDVIVLTDVKLDELLLANIDRILKDDGLIAFATKSFSEDEEQLFDDLKLVGSKFWIA
MPFKFGHNTSIIASKKYHPTADLNLQRADLLDDLQYYSAEIHNASFVFPAREHKALTGIA
KR
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataataacgcatttaatgaaatgatggtacatataccactttgtacacataaa
gaagcttcaaaagttttaattattggaacaataaacgacaatttaaaaatagaagcttct
aaacataataaaatttcaaatattgaatttggagatttagcatttttaaaatcacacaat
gaaaaaaatgttgatgtgatagttttaacagatgtaaaacttgatgaattattactagca
aatatcgatagaatcttaaaagatgatggtcttatagcttttgctacaaaatctttttca
gaagatgaagaacaattatttgatgatttaaaacttgttggttcaaaattttggatagct
atgccatttaaatttggacataatacttcaatcattgcatcaaaaaaatatcatccaact
gcagatttaaatcttcaaagagctgatttacttgatgatttacaatactattcagcagaa
atccataatgcttcatttgtattccctgcaagagaacacaaagctctaactggtattgca
aaaagataa

DBGET integrated database retrieval system