KEGG   Arcobacter butzleri 7h1h: A7H1H_2159Help
Entry
A7H1H_2159        CDS       T02755                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acp] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
abl  Arcobacter butzleri 7h1h
Pathway
abl00061  Fatty acid biosynthesis
abl00780  Biotin metabolism
abl01100  Metabolic pathways
abl01212  Fatty acid metabolism
Module
abl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:abl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A7H1H_2159 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A7H1H_2159 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abl01004]
    A7H1H_2159 (fabZ)
Enzymes [BR:abl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     A7H1H_2159 (fabZ)
Lipid biosynthesis proteins [BR:abl01004]
 Fatty acid synthase
  Component type
   A7H1H_2159 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AGR78401
UniProt: S5PDJ1
LinkDB All DBs
Position
complement(2106990..2107433)
Genome map
AA seq 147 aa AA seqDB search
MLDIMQIQEILPHRYPLLLVDRITDMEVKKSIKGYKNISISEPAFQGHFPGHPIYPGVLI
LEGMAQCGGVLALKSSDLTDEEMKNKVIYFMSIDNAKFRNPVRPGDRLDYELTAVKMKST
LMVLEGKAYVDGKLTAEAEFKAMIVDK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgttagatattatgcaaattcaagagattctacctcatagatacccgttactacttgtg
gatagaattacagatatggaagtaaaaaaatctattaaaggttataaaaatatttctatt
tcagaaccagcttttcaaggacatttccctggacatccaatttatcctggtgttttaatt
ttagaaggaatggctcaatgtggtggtgttttagctctaaaaagttctgatttaacagac
gaagagatgaaaaataaagtaatctattttatgagtattgataatgcaaaatttagaaat
ccagttcgtcctggagatagattagattatgaattaacagcggttaaaatgaaaagtaca
ttgatggtacttgaaggaaaagcttatgttgatgggaaacttacagcagaagccgaattt
aaagctatgatagtagataaatag

DBGET integrated database retrieval system