KEGG   Acinetobacter baumannii SDF: ABSDF1475
Entry
ABSDF1475         CDS       T00660                                 

Definition
(GenBank) putative N-6 Adenine-specific DNA methylase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
abm  Acinetobacter baumannii SDF
Brite
KEGG Orthology (KO) [BR:abm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:abm03009]
    ABSDF1475
Enzymes [BR:abm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     ABSDF1475
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     ABSDF1475
Ribosome biogenesis [BR:abm03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ABSDF1475
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 MTS N6_Mtase Lipase_GDSL_2
Other DBs
NCBI-ProteinID: CAP00819
UniProt: B0VLH0
LinkDB
Position
complement(1379920..1382124)
AA seq 734 aa
MNTSLRLNHYWITCADGLETLLQEEIEQLGTKVTERKAGRLIIEGTLEHAYRICMWSRLA
SRVLLPIHTYELERTHDARDVAEELYEGAISFDWSLIFAPQSTFAIRLHAEREIKVNTQF
ATLRVKDGVVDSFMEAVGRRPSIDTKQPEITLYVLAGKTEHTYCLDLSGDSLHKRGYRRF
MTDAPIKENLAAAILQKAKLQERNPEIVLDPMCGSGTFIIEALMILTDRAPGLVRRFGFN
GWHGHDRELWLSLKAEAAERHEKALEQPLPKFYAYDADWEAVKATRENIIAAGFEKLLGD
IQIEERTLADWPDFGAENKTAFIVTNPPYGERLGDKASNRSLYLGLSALLQKNFPNQYAA
IIAAQIEQADVLAFEAPETLRLMNGKLPIYVRFGTVKLEKVTQPFLANWQAQPVEMEEAQ
DFANRLQKNMTALKKWATKENIYCLRLYDADLPDFNLAVDLYSDRLHVQEYAPPKKIDPE
KAKKRFNLALAAIRAVTGLNRDAIFIKTRARQTGTNQYTKQSTANKRFIVQEGKAKILVN
LTDYLDTGLFLDHRQMRLRIAQEARGKHFLNLYSYTSTASLHAALGGAASTTSVDLSNTY
LSWSKENFVLNGLTVDHADEQHMFFASDCFEWLKEGHEQYDLIFIDPPTFSNSKKFHGTF
DVQRDHVSLIKRAMNRLTSEGTLYFSNNYRGFEMDEEIEALYDVEEITSETIGPDFKRNQ
KIHRAWKIQHPGLN
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgaatacctctttacgtttaaaccactattggattacttgtgctgatggtttagaaacc
ctcttacaagaagaaatagaacagcttggcaccaaagtgacagaacgtaaagcaggacgt
ttaatcattgaaggaacgcttgaacatgcttaccgtatttgcatgtggtcacgtcttgct
tcacgtgttttacttccaattcatacttatgaacttgaacgtacccacgatgcacgtgat
gtagcagaagagctttatgaaggtgcaattagttttgattggtctcttatctttgcacca
caaagtacctttgcaattcgcttacatgcagagcgtgaaattaaggtaaatacgcagttt
gcaacccttcgtgtaaaagacggcgttgttgattcctttatggaagctgtaggtcgccgc
ccaagtattgataccaaacaaccggaaattacattatatgtgcttgcgggcaaaaccgag
catacatattgcctagatttatctggtgattcattacataaacgcggctaccgtcgtttc
atgacagatgcgccaattaaagaaaacctcgcagcagcaattttacaaaaagccaagctt
caggaacgtaacccggaaatcgtacttgacccaatgtgtggttcaggcacatttattatt
gaagcgttaatgattttaactgatcgtgcgccgggtcttgtacgtcgttttggttttaat
ggctggcatggtcatgaccgtgaactttggctttcactcaaagcggaagcagcagagcgt
catgaaaaagcacttgaacaaccgttacctaagttttatgcatacgatgctgactgggaa
gctgtaaaagcaacacgcgaaaacattattgcagcaggttttgaaaagctactaggcgat
attcaaattgaagagcgtactttagcagactggccagatttcggtgctgaaaataaaact
gcttttatcgttaccaaccccccatatggtgagcgcttaggtgacaaagcttctaaccgt
tctctttacttaggtttatctgccctcttacaaaagaacttcccaaatcaatatgcagca
attattgccgcacaaattgaacaagcggatgttttagcatttgaagcaccagaaacatta
cgcttaatgaatggtaaattaccgatttatgttcgtttcggtacagttaaacttgaaaaa
gtcactcaacccttcttggcaaactggcaagctcaacctgttgaaatggaagaagctcaa
gactttgctaaccgtttgcaaaagaacatgactgccttgaaaaaatgggcaaccaaagaa
aatatctattgcttacgtttatacgatgcagacctccctgactttaaccttgctgtagac
ttatatagcgaccgtttacatgttcaggaatatgcaccacctaaaaagattgatcctgaa
aaagcaaaaaaacgttttaacttagcgcttgctgctattcgtgcggtaacaggattaaat
cgcgatgcaatctttattaaaacacgtgcgcgtcaaactggtacaaatcagtacaccaaa
caaagtacagccaataaacgtttcatcgtgcaagaaggtaaagctaaaattttagtgaac
ctgactgactaccttgatactggtttgttccttgaccaccgtcaaatgcgtttacgtatt
gctcaagaagcacgtggtaagcacttcttaaatctttatagttatacatcgacagccagc
ttacacgcggccttaggcggcgctgcaagtacaaccagtgtagatttatctaatacttac
ttgagctggtcaaaagaaaacttcgttttaaacggtttaacggtagatcatgcagacgaa
cagcacatgttctttgcaagtgactgttttgaatggttaaaagaaggtcatgaacaatat
gatcttatttttattgacccgccaacattctctaactctaaaaagttccacggtactttt
gatgtgcagcgcgatcacgtatctttgattaaacgtgcaatgaaccgcttaacaagtgaa
ggtacactttacttctcaaataactatcgtggttttgagatggatgaagagatcgaggct
ttatatgacgttgaagaaattacttctgaaacgattggacccgattttaaacgtaatcaa
aaaatccaccgtgcatggaaaattcagcatccagggctaaactaa

DBGET integrated database retrieval system