KEGG   Acinetobacter baumannii SDF: ABSDF1934Help
Entry
ABSDF1934         CDS       T00660                                 

Definition
(GenBank) putative (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:abm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ABSDF1934
Enzymes [BR:abm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ABSDF1934
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ABSDF1934
    1.1.1.-  
     ABSDF1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: CAP01269
UniProt: B0VPN6
LinkDB All DBs
Position
1794396..1795469
Genome map
AA seq 357 aa AA seqDB search
MREIIMKAAHFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCG
HPHPISGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLS
KNMNFIGLGGRGGGLSEKIAVRRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGD
IALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVM
KITNGDGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRG
TIAYVNDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttgagggagataataatgaaagcagcgcatttttatgacagaggcgatatacgtattgaa
gatatccctgaaccagaagtcactcccggcactgtaggcattaaagtagcttggtgtgga
atctgtggtacagatttgcacgaatttatggaagggccaatttttattccaccttgtgga
catccgcatcctatttcaggtgaatctgcgccgattaccatgggacatgaattttcaggt
gtggtttatgccgttggtgaaggtgttgatgatattgaaattggccagcatgtagtcgta
gagccttatattgtggcggatgatgtaccgactggaccgggcgataattatcatctttcc
aaaaatatgaactttattggtttaggcggtcgtggcggtggtttatcggagaaaattgcg
gttagacgccgttgggtgcatccaatttccaataaaattccactggatcaggcagcctta
attgaaccgttatcggtgggtcatcatgctttcgtacgtagtggtgcaaaggccggtgat
attgcactggttggcggtgcggggccaattggtttattgctttcggcaattttaaaagcg
aaagggcttaaggttatcattaccgaactaagtgccaaacgtaaagaaaaagccaaagag
tcgggagttgcagattatattttagacccgtcagaagttgatgttgtttctgaggtcatg
aaaattactaatggcgatggtgttgatgttgcatttgaatgtagtagcgttaacaaggtg
ttagatactttggtcgcggcagtgaaaccaacaggcgttatagttattgtttcgatttgg
agccacccagcatcaattaatgtgcacagtgttgtaatgaaagagctcgatgtaagaggc
acaattgcctacgtaaatgaccatcaagaaaccattaaactggtcgaagaaggtaaaata
aatctggaaccttttattacccagcgcattcaacttgatgatttgatttcacaaggtttt
gaaaccttaattcataacaatgaatcagccgttaagattattgtacatccataa

DBGET integrated database retrieval system