KEGG   Acinetobacter baumannii SDF: ABSDF1935Help
Entry
ABSDF1935         CDS       T00660                                 

Definition
(GenBank) conserved hypothetical protein; putative membrane protein
  KO
K08994  ion channel-forming bestrophin family protein
Organism
abm  Acinetobacter baumannii SDF
Brite
KEGG Orthology (KO) [BR:abm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abm02000]
    ABSDF1935
Transporters [BR:abm02000]
 Other Transporters
  Pores ion channels [TC:1]
   ABSDF1935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bestrophin Zds_C
Motif
Other DBs
NCBI-ProteinID: CAP01270
UniProt: B0VPN7
LinkDB All DBs
Position
complement(1795516..1796427)
Genome map
AA seq 303 aa AA seqDB search
MIVRDKSNVFKLLFAWKGTILPKVLPALSFVVLISACVVWLSYYHWIQIPTVPAIGFTIF
GVILSICTGFRNNACYDRWWEGRKVWGALIANARHIVRDSHVLSNEKREHLIHQVLIFSN
LLRDRLRQQTVEPTKFLEHAYLNNSSLNYLNEHINAPQFVLENIQKDLVKALKDGEISDI
IYSTLNRHIIELGNIQAGCDRIAGTPLPYSYSVLLHRAVYCFCFILPFSLEAALGIWTPL
IVGLIAYMFLGLDALSAQIEEPFGLQENDLPLDSIVRLIERESLSSLGQPLPPIIEAQDN
NLL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgattgttcgtgataaaagcaatgtatttaaactcttatttgcttggaaaggaacaatt
ttaccaaaggttttgcctgcactgagttttgttgtacttatttcagcgtgtgtggtctgg
ctctcttattatcattggattcaaatacctaccgtacccgcgatcggatttaccatcttt
ggtgtgattctttcgatttgtacgggctttcgaaataacgcatgttatgaccgatggtgg
gaaggtcgcaaggtctggggggctttaattgccaatgccagacatattgttagagatagc
catgttttatctaatgaaaaacgcgaacatttaattcatcaggtcttaatttttagtaac
ttattgcgtgatcgtttacgtcaacaaacagttgaacccacaaaatttcttgaacatgcc
tatttaaataactcttcacttaattatttaaatgagcatattaatgcacctcaatttgta
ctcgaaaatattcaaaaggatttagtcaaagctctaaaagacggtgaaattagtgacatc
atctatagcacgctaaatcgacatattattgagctaggtaatattcaagcgggttgtgac
cgtattgctgggacacctttaccctactcatattcagtacttttacatcgtgctgtttac
tgtttctgttttatattaccgtttagccttgaagcagctttaggtatttggacaccgctg
attgtgggtttaatcgcttatatgtttttaggtttagatgctctaagtgctcaaattgaa
gagccttttggtttgcaagaaaatgatttaccgctcgattctattgttcgtttaattgaa
cgggagtctctaagctctttagggcagccattaccacccattattgaagcccaagacaac
aatttactttaa

DBGET integrated database retrieval system