KEGG   Acinetobacter baumannii SDF: ABSDF1937Help
Entry
ABSDF1937         CDS       T00660                                 

Definition
(GenBank) conserved hypothetical protein
Organism
abm  Acinetobacter baumannii SDF
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B DUF5317
Motif
Other DBs
NCBI-ProteinID: CAP01272
UniProt: B0VPN9
LinkDB All DBs
Position
1797960..1798655
Genome map
AA seq 231 aa AA seqDB search
MFFKQFFEQESSTYTYMLGCEETREAVLIDPVASDIEIYAKELEQHQFTLIYTLDTHVHA
DHITAADLLCERFHCKSVLHRNSEVSCGDILITDGCMLKVGNLSIEARYTPGHTNACTSY
LVENMVFTGDALLIDGCGRTDFQQGNAGTLYDSIHKQLFSLPDETIVYPGHDYKGRLSST
IGYERLNNSRLGQNRSREDFTELMNNLNLPYPKQIDKALPANQACGSISQL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgttctttaagcagttttttgagcaggaaagttcgacttatacatatatgcttgggtgt
gaagaaacacgagaggctgttttaattgacccagtcgcatcagatatagagatttatgca
aaagaattagagcagcatcaatttacactcatctataccttagatactcatgttcatgca
gaccatattaccgctgcagatttactttgcgaacgtttccattgcaaatcggttttacat
cgaaactcagaagtaagttgcggagatattttaattactgatggttgcatgcttaaagtt
ggcaacctcagtattgaagcgcgttacacaccaggtcataccaatgcttgtacgagttac
ttggttgaaaacatggttttcactggtgatgcattattaattgatgggtgcggtcgaact
gacttccaacaaggtaatgcaggcacactttatgacagtattcataagcaacttttcagc
ctacctgacgagactattgtgtatccgggacacgattataaaggtcgtctgtcttcaaca
attggttatgaacgcttaaataattcacgtctaggtcagaatcgttcgcgtgaagatttt
actgaattaatgaataacttaaatctgccatatccaaaacaaatcgataaagcacttcct
gctaatcaggcttgcggctcaatttcacaattataa

DBGET integrated database retrieval system