KEGG   Acinetobacter baumannii SDF: ABSDF2921Help
Entry
ABSDF2921         CDS       T00660                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
abm  Acinetobacter baumannii SDF
Brite
KEGG Orthology (KO) [BR:abm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ABSDF2921
Enzymes [BR:abm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     ABSDF2921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: CAP02211
UniProt: B0VV98
LinkDB All DBs
Position
complement(2682929..2683549)
Genome map
AA seq 206 aa AA seqDB search
MIDLYYWGTPNGHKITIALEEMGLDYTLYPINILENDQFQPDFLKISPNNKIPAIVDQDG
PRGEPISVFESGAILQYLGRKTGLFYPTDEQERVEVEQWLMWQMGGLGPMLGQNHHFNRF
APEKIPYAIDRYVNETKRLYGVLNKQLIRQKFVAGEYSIADMAILPWILRYEWQGIQLED
YPYVQEYIVRLTARPAVQKALSIKVI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgattgatctatattattggggcacacccaatggacataaaatcacaattgccttagaa
gaaatgggactggattacaccctttacccaattaatattttagaaaatgatcaatttcaa
ccagacttcctgaaaatttctccgaataataaaattcctgccattgttgaccaagatggt
ccacgtggtgagccaatttcagtatttgaatcaggcgcaatcttgcagtatttaggacga
aaaactggattgttctacccgacagacgagcaagagcgagttgaagtggaacaatggctt
atgtggcaaatgggtggcttaggtcctatgttgggacaaaatcatcattttaaccgcttt
gcgccagagaaaattccctatgctatagaccgctatgtaaatgagactaagcgtttatat
ggtgtgttgaataaacagctcattcgtcagaagtttgttgcaggggaatactccattgct
gatatggcaattctaccttggattttgcgttatgaatggcaggggattcaattagaggat
tacccgtatgtacaagaatacattgttcgcttaacagcacgccctgcagtacaaaaagca
ttatctattaaagtcatctaa

DBGET integrated database retrieval system