KEGG   Acinetobacter baumannii AB0057: AB57_0294Help
Entry
AB57_0294         CDS       T00793                                 

Gene name
sul1
Definition
(GenBank) sulfonamide-resistant dihydropteroate synthase
  KO
K18974  dihydropteroate synthase type 1 [EC:2.5.1.15]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00790  Folate biosynthesis
abn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AB57_0294 (sul1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:abn01504]
    AB57_0294 (sul1)
Enzymes [BR:abn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AB57_0294 (sul1)
Antimicrobial resistance genes [BR:abn01504]
 Gene variants
  Sulfonamide resistance genes
   Dihydropteroate synthase
    AB57_0294 (sul1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACJ39720
LinkDB All DBs
Position
315492..316331
Genome map
AA seq 279 aa AA seqDB search
MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVSPAD
EIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADC
RLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFFL
SPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPVKDLGPASLAAELHAIGN
GADYVRTHAPGDLRSAITFSETLAKFRSRDARDRGLDHA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggtgacggtgttcggcattctgaatctcaccgaggactccttcttcgatgagagccgg
cggctagaccccgccggcgctgtcaccgcggcgatcgaaatgctgcgagtcggatcagac
gtcgtggatgtcggaccggccgccagccatccggacgcgaggcctgtatcgccggccgat
gagatcagacgtattgcgccgctcttagacgccctgtccgatcagatgcaccgtgtttca
atcgacagcttccaaccggaaacccagcgctatgcgctcaagcgcggcgtgggctacctg
aacgatatccaaggatttcctgaccctgcgctctatcccgatattgctgaggcggactgc
aggctggtggttatgcactcagcgcagcgggatggcatcgccacccgcaccggtcacctt
cgacccgaagacgcgctcgacgagattgtgcggttcttcgaggcgcgggtttccgccttg
cgacggagcggggtcgctgccgaccggctcatcctcgatccggggatgggatttttcttg
agccccgcaccggaaacatcgctgcacgtgctgtcgaaccttcaaaagctgaagtcggcg
ttggggcttccgctattggtctcggtgtcgcggaaatccttcttgggcgccaccgttggc
cttcctgtaaaggatctgggtccagcgagccttgcggcggaacttcacgcgatcggcaat
ggcgctgactacgtccgcacccacgcgcctggagatctgcgaagcgcaatcaccttctcg
gaaaccctcgcgaaatttcgcagtcgcgacgccagagaccgagggttagatcatgcctag

DBGET integrated database retrieval system