KEGG   Acinetobacter baumannii AB0057: AB57_1180Help
Entry
AB57_1180         CDS       T00793                                 

Definition
(GenBank) EamA family transporter
Organism
abn  Acinetobacter baumannii AB0057
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA
Motif
Other DBs
NCBI-ProteinID: ACJ40204
LinkDB All DBs
Position
complement(1263937..1264833)
Genome map
AA seq 298 aa AA seqDB search
MQNQTASNLPSTQLGKALLCLMTSALLFSIMGVCIRFASETVDNATVVFFRNAVGLFIFI
PMLFKQGLDFIKTDKLWMHTWRSIVGLAAMYGFFYAIANLKLSNAMVFSYSSPIFIPLIA
WLFLKEKITKSMIFAAVIGLIGVLFVAKPDQGLFNALSFIGLGACFLSAMAFVTVRALTS
TEPPERIVFYFCVFGSLISSIPMFWHWRIFTWHELALLIAAGLLANISQLFMSYAYSLAP
AGQIGPMNYIAIIFAGIWGFVFWHELPDLFSIIGIFIILFAILLCNPFLQKKLLSRFK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcagactgcttcaaatctcccctcaactcaacttggaaaagcactgctttgt
cttatgacatcggcattattattttccattatgggagtgtgcattcgttttgcttcagaa
acagtggacaatgcgaccgtcgtgttttttagaaatgcagtgggtttatttatttttatt
ccgatgctctttaaacaaggtttagactttattaaaaccgataaactttggatgcacact
tggcgaagtattgtgggactagccgccatgtacggttttttctatgccattgcaaactta
aaactctcaaatgccatggtttttagttactcatctcctatctttattccacttattgca
tggcttttcttaaaagaaaaaattactaaatcgatgatttttgccgctgtgattggactc
attggggttttatttgtcgctaaacccgaccaaggtctatttaacgcattgtcttttatt
ggcttgggtgcatgctttttatcagcaatggcttttgtcaccgtaagagctttaaccagt
acagagccacctgaacgtatcgttttttacttctgtgtttttggtagtttaatttcctct
attccgatgttctggcattggcgaattttcacttggcatgaactagcactactcattgcc
gcaggacttttagcaaatataagccaactttttatgtcttatgcttatagcttagcccca
gcaggccaaattggcccaatgaattacattgcgattatttttgcaggaatttggggattt
gttttttggcatgaattaccggatctattcagtattatcggtatatttattattttattt
gcgattttgctctgtaatccatttttgcagaaaaagttactctctcgatttaaataa

DBGET integrated database retrieval system