KEGG   Acinetobacter baumannii AB0057: AB57_1190Help
Entry
AB57_1190         CDS       T00793                                 

Definition
(GenBank) hypothetical protein
Organism
abn  Acinetobacter baumannii AB0057
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3237
Motif
Other DBs
NCBI-ProteinID: ACJ40213
LinkDB All DBs
Structure
PDB: 

Position
complement(1275483..1276019)
Genome map
AA seq 178 aa AA seqDB search
MKKVVTLLCGICLIGLTHAETQYNPPPIQLEPLAKFSVDLNAPVWELGTTSDAGKRRIIP
ITGGTFEGKSLKGRILNNGADWQIVDSKGLAIIDTRYLLETDDGALIYLQTKGYRHGSAE
TLKQLAQGKDVDPKNYYFKITMQFETSSPKYSWLNQTVAVGSAMRLGKAVIYDAYTLK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagttgtaacactactctgcggaatttgtctcattggcctaactcatgccgaa
actcaatataacccaccacctattcagcttgagcctttagcaaaatttagtgttgattta
aatgctcctgtttgggagttaggtaccaccagtgatgcaggtaaacgccgaattattccc
attacaggtgggacattcgaaggcaaatcacttaaaggccgcattttaaataatggtgca
gattggcaaattgtcgacagtaaaggactagccattattgatacgcgatatttgttagaa
accgatgacggtgcgcttatttaccttcaaaccaaaggttaccgccatggctcggcagag
acgctaaaacaacttgcccaaggcaaagatgtcgacccgaaaaattactatttcaaaatt
accatgcagtttgaaaccagctcacctaaatactcatggcttaaccagaccgttgcggta
ggtagtgcaatgcgcttgggcaaagcggttatttatgatgcctataccctgaaataa

DBGET integrated database retrieval system