KEGG   Acinetobacter baumannii AB0057: AB57_1195Help
Entry
AB57_1195         CDS       T00793                                 

Definition
(GenBank) p-hydroxycinnamoyl CoA hydratase/lyase
  KO
K18383  trans-feruloyl-CoA hydratase / vanillin synthase [EC:4.2.1.101 4.1.2.41]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00998  Biosynthesis of various secondary metabolites - part 2
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    AB57_1195
Enzymes [BR:abn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.41  vanillin synthase
     AB57_1195
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.101  trans-feruloyl-CoA hydratase
     AB57_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACJ40218
LinkDB All DBs
Position
complement(1282079..1282912)
Genome map
AA seq 277 aa AA seqDB search
MSYENRWETVDVKVEDGIAWVTLNRPEKKNAMSPTLNREMIDVLETLELDQNAKVLVLTG
AGDSWTAGMDLKEYFREVDTQPEIFQERIRRDSCRWQWQLLRMYSKPTIAMVNGWCFGGG
FSPLVACDLAIAADEATFGLSEINWGIPPGNLVSKAMADTVGHRASLYYIMTGKTFSGKE
AETMGLVNKSVPLAQLKAEVTELANCLLEKNPVVLRTAKNGFKRCRELTWDQNEDYLYAK
LDQCIHRDTENGRQEGLKQFLDEKSIKPGLQSYKRTG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagttatgaaaaccgctgggaaacagtagatgttaaagttgaagatggaattgcatgg
gtcactttaaaccgccctgaaaagaaaaatgccatgagcccaaccctcaatcgtgaaatg
attgatgtgcttgaaacccttgagcttgatcaaaatgctaaagttttggttctgactggt
gcaggcgactcttggacagcgggtatggatttgaaggaatatttccgtgaagtcgacact
caaccagaaattttccaagagcgtattcgtcgtgactcatgtcgctggcagtggcaactt
cttcggatgtattcaaagccaaccattgccatggttaacggctggtgtttcggaggcggt
ttctcacctttagtggcgtgtgacctcgcaattgcagcagatgaagcaactttcggttta
tctgaaattaactggggtatcccaccgggcaaccttgtaagcaaagcaatggcagatacg
gtaggtcatcgtgcatctttgtattacatcatgacgggcaaaacttttagcggtaaagaa
gccgaaaccatgggccttgtgaacaaaagcgtaccgcttgcccaattaaaagcagaagta
actgaacttgcaaattgcttactcgagaaaaaccctgtggttcttcgtaccgctaaaaat
ggctttaagcgttgccgtgaactgacatgggaccaaaacgaagattacttatatgccaaa
ctcgatcaatgtatccaccgagataccgaaaatggtcgccaagaaggtttgaaacaattc
ttagatgaaaaatcaattaaaccgggtttacagagctataaacgtactggttaa

DBGET integrated database retrieval system