KEGG   Acinetobacter baumannii AB0057: AB57_1337Help
Entry
AB57_1337         CDS       T00793                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
abn  Acinetobacter baumannii AB0057
Brite
KEGG Orthology (KO) [BR:abn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AB57_1337
Enzymes [BR:abn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AB57_1337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO FAD_binding_3 Thi4 K_oxygenase AlaDh_PNT_C NAD_binding_8 Cytochrom_C_2 FMO-like Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ACJ40357
LinkDB All DBs
Position
complement(1423016..1424581)
Genome map
AA seq 521 aa AA seqDB search
MLDQNIKTQLKAYLERLESPIELVAALDESDKAAQIKELVTEIAELSDKVTARFDGNNTR
RPSFGVAKAGEQPRVFFAGLPMGHEFTSLILALLQVSGYAPKVSDEVLNQIKGLNLKANF
DVFVSLSCHNCPDVVQALNLIAIYNPNTTATMIDGAFFQDEVEQRKIMAVPMVFQDNEHI
GQGRMTLEEIVAKLDTNSAEKDAAALNAKDAFDVLVIGGGPAGATAAIYAARKGINTGIV
AERFGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYDVDIMNLQRVSKITGADQTAN
GLVEVELENGAKLESKTVILSTGARWREMNVPGEAEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQNKLNSLPNTTVIMNALSTEVLGD
GSQVTGLKYKDRATDEEHVVELAGIFVQIGLLPNTDFLKDSEVELTNRGEIIVNDRNETN
VKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaacattaaaactcaattaaaagcttacctagaacgtttagaaagtcca
atcgaattagttgctgctttagatgaatcagacaaagctgctcaaattaaagaattagta
actgaaatcgctgagctttctgacaaggtaacagcccgttttgacggtaacaatacacgt
cgtccaagctttggtgtggctaaagcaggtgaacaacctcgtgtgttctttgcaggctta
ccaatgggccatgagtttacgtctttgatcctggctctgttacaagtgtctggctatgca
cctaaagtgtcggatgaagtgcttaaccagattaaaggcttaaacctcaaagctaacttt
gatgtattcgtatcattaagctgtcataactgtccggacgtggtacaggcgcttaacctg
attgccatttataacccgaacaccacggcaaccatgattgatggtgcattcttccaagac
gaagtggaacaacgcaaaatcatggctgtaccgatggtcttccaggacaatgaacacatt
ggtcaaggtcgtatgacccttgaagagattgtggcaaaacttgataccaactcagctgaa
aaagacgcagcagcactcaatgccaaagatgcgtttgatgtattggtgattggtggtgga
cctgcgggtgcaacagctgcaatctatgcggcacgtaaaggcattaacacaggtatcgtg
gctgaacgctttggtggtcaggtcatggacaccatggacattgaaaacttcacttctgtg
caaaagactcaaggtcctaagtttgctgccgagatggaagcacatgttcgtgaatacgat
gtcgatatcatgaacctgcaacgtgtcagcaaaatcacgggtgcagaccaaacagcaaat
ggcttggttgaagttgaacttgaaaacggtgcaaaacttgaatcgaaaactgtgatcctt
tcaacaggggcacgttggagagaaatgaatgtaccgggtgaagctgaataccgtacccgt
ggtgtagcgtactgtccacactgtgatggtccattgttcaaaggcaaacgtgttgccgtg
attggtggcggtaactcaggtgttgaagcggcgattgaccttgcaggtattgttgagcat
gtaactctggttgagttcgacactaaacttcgtgctgaccaagtcttgcaaaacaagtta
aacagcttgccaaacaccactgtgattatgaatgcattaagcacagaagtattgggtgac
ggttcacaagtaaccggtcttaaatataaagaccgtgcgactgatgaagagcatgtggta
gagcttgcagggatctttgtacagattggtttacttccaaacactgacttcttaaaagat
agtgaagttgagctaaccaaccgtggagagatcattgtgaatgaccgcaacgaaaccaat
gtaaaaggtgtatttgctgcaggtgactgtaccactgtaccgtacaagcaaatcattatt
gctacaggtgaaggcgctaaagcatcactctctgcgtttgattacatcattcgttctggg
cagtaa

DBGET integrated database retrieval system