KEGG   Acinetobacter baumannii AB0057: AB57_2893Help
Entry
AB57_2893         CDS       T00793                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06177  tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29]
Organism
abn  Acinetobacter baumannii AB0057
Brite
KEGG Orthology (KO) [BR:abn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:abn03009]
    AB57_2893
   03016 Transfer RNA biogenesis [BR:abn03016]
    AB57_2893
Enzymes [BR:abn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.28  tRNA pseudouridine32 synthase
     AB57_2893
    5.4.99.29  23S rRNA pseudouridine746 synthase
     AB57_2893
Ribosome biogenesis [BR:abn03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AB57_2893
Transfer RNA biogenesis [BR:abn03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    AB57_2893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ACJ42238
LinkDB All DBs
Position
complement(2988806..2989444)
Genome map
AA seq 212 aa AA seqDB search
MSDFLSEHLIYRDDDFMVIHKPSDILSVPGKGDLHDSVLTRLVAIEPRTLLIHRLDRDTS
GILVFGLSKRGQSAIARQFQDRQTSKIYEALVAGHLEGEGTVDIPVVYDPSRPPLHIVDA
SHNKPALTHWQAIEHFQIQGQPVTRVKLTPITGRSHQLRVHMQYLGHPIVGDTLYAAPEQ
LLVPRLCLHAKQLSFNHPVTGESLTFNCPVPF
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgattttctaagtgaacatctgatctatcgtgatgatgattttatggtgattcat
aaaccttcggacatcttgagtgtgccagggaaaggtgatttacatgacagcgttttgaca
agactggtggcaattgaaccacgaactttgctcattcaccgccttgaccgtgatacttcg
ggtattttggtttttgggttatctaagcgtggacagagtgcgattgcacgccaatttcaa
gaccgtcaaacttcgaaaatatatgaagcgctagttgctggtcatttagagggtgaaggg
acagtggatatccctgtcgtctatgatccgagtcgaccacctttacatattgtcgatgct
tctcataacaaacctgctttaacacattggcaggcgattgaacatttccagattcaggga
caaccggttacgcgtgtcaaattaacaccgattaccggacgttctcatcaactccgtgta
cacatgcaatatctgggacatccgattgtaggtgatacattgtatgcagcaccggaacaa
ttacttgttcctcgtctgtgcttgcatgctaaacagttaagctttaatcatcctgtcaca
ggggaatcattaacttttaactgtcctgtaccgttttaa

DBGET integrated database retrieval system