KEGG   Alcanivorax borkumensis: ABO_0680Help
Entry
ABO_0680          CDS       T00380                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00620  Pyruvate metabolism
abo00680  Methane metabolism
abo01100  Metabolic pathways
abo01120  Microbial metabolism in diverse environments
abo01200  Carbon metabolism
Module
abo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:abo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABO_0680 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    ABO_0680 (ppc)
Enzymes [BR:abo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ABO_0680 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Rrn6
Motif
Other DBs
NCBI-ProteinID: CAL16128
UniProt: Q0VRS0
LinkDB All DBs
Position
756253..758919
Genome map
AA seq 888 aa AA seqDB search
MDHNVNAPLRDDVRLLGDLLGECLRQQAGDSIYETVEKIRQASVATRTEGGASLASLRDL
LSPLDDATLLEVARAFSQFLNLSNIAEQHHRERLHRQHQRYPGDAGTDQGLQEVLQRLAD
NDIAKEQISGTLEQLSVELVLTAHPTEVTRRTLIRKYDQMADLLSELDRPDFNEDERELR
RERLRRVILAAWCTDEIRREKPTPVDEAKWGFATIEQSLWQAVPDVLRQLEAQLADRGLP
APPSDWAPVKLASWMGGDRDGNPNVTAPVTREVLLLARWMAADLYLRDVENLLADLSMKS
ASEELLAATGPTHEPYRVLLREVRSRLRLTRRQMEAQVEGLPVPEGQAYLRREELMAPLQ
LLDRSLRAVGLSDIADGDLKNTLRRLNCFGITLLRLDIRQESTRHSDVLDAITRYLQLGR
YSDWDEAARQAFLVDELQARRPLIDAAFRDSEHCTAEVAEVLATCEVIAEQGSEGLGAYV
ISMATTPSDVMAVMLLQKIAGVREPMRVVPLFETLDDLDGAEQTMSALLALPFYRERVAA
GQEIMIGYSDSAKDAGFLGAAWAQYRAQEKLTALFADNGIPLTLFHGRGGSISRGGSPTR
MALLSQPPGSVAGRIRVTEQGEVIRFKYGRPSVAVFNLEQYVAATLEATLLPPQAARPEW
RQQMQALTDTSVAGYRGVVRDEPELVRYLRTVTPETELSRLALGSRPARRKSDQGISSLR
AIPWVFAWTQIRLMLPAWLGTGAALEDAQNDAAQHAMVREMASEWPFFQGVVDMLEMVLA
KSDLRVAAWYEERLAGDDPGLMRLGEVLRERLTATVSALSALTGREDLLDNNPVMRWSIR
VRDPYTDPLHLLQAELMARLRQQDGDETLESALMVTIAGIAAGLRNTG
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
gtggatcacaatgtaaatgcaccattgcgtgatgatgtccggttattgggtgatttgttg
ggcgagtgcctgcgccagcaggcgggcgattccatttacgagacggtggaaaaaatccgc
caagcctcggtggcgacccgcaccgaagggggggcgtcactggcctcgttgcgcgattta
ttatcgccgctggatgacgcgactctgctggaggtcgcgcgtgcgttcagtcagtttctt
aacttgagcaatattgccgagcaacatcaccgggagcggttgcatcgtcaacaccagcgc
tatccgggggatgcgggtactgatcaggggttgcaggaggtgctgcagcgcctggccgat
aatgacattgccaaagagcaaatttcgggaacgcttgagcagctttctgtcgagctggtg
ctgacggcccaccccaccgaggtgacccgccgtacgttgattcgcaagtatgaccaaatg
gccgatctgctcagtgagctggatcgcccagacttcaatgaagacgagcgtgagttgcgc
cgcgaacgtctgcgccgggtgattctggcggcctggtgcaccgatgaaattcgtcgtgaa
aagccgaccccggtggacgaagccaaatggggctttgccaccattgaacaatccctgtgg
caggcggtgcccgatgttctgcgccaactggaagcacagctggccgaccgggggctgcct
gcgcccccctccgactgggcgccggtgaagttggcgtcgtggatgggcggtgaccgggat
ggtaaccccaatgtgaccgccccggtgactcgggaagtgttgctgctggcccgctggatg
gcggcagacctgtatcttcgcgatgtggagaacttgctggcggacctgtcgatgaagtcg
gccagtgaggaattactggcggccactggcccaacccatgaaccttaccgtgtgctgctg
cgcgaagtgcgtagccgcttacgcctgactcgtcgccagatggaagcacaagtagaaggc
ttaccggtgccggagggccaagcctatttacgccgtgaagagttgatggcgccgttacag
ttgctcgaccgttcattgcgtgccgtgggcctaagtgacattgccgatggcgatttaaaa
aatactcttcgccgcctgaactgtttcggtatcaccctgctacggctggatattcgtcag
gaatcgacccgtcacagtgatgtgttggatgccatcacccgttatctgcagttgggtcgt
tacagcgattgggatgaggcggcgcgccaagcgtttctggttgatgagctgcaggcacgt
cgaccgctgattgatgccgctttccgcgacagcgaacactgcactgccgaagtcgcagag
gtattggcaacgtgtgaggtgattgccgagcaaggcagcgaagggctaggtgcctatgtg
atttccatggccactaccccgtctgatgtgatggcggtgatgttgttgcagaagatagcc
ggggttcgtgaacccatgcgcgtggtgccgctgttcgagaccttggacgatttggatggt
gccgagcaaaccatgtcagcgttgttagcgctgccgttctatcgagagcgagtggctgcc
gggcaggaaatcatgattggctattcagattccgccaaggacgcgggctttctcggcgcg
gcctgggcccaatatcgggcacaggaaaagctcacggccctgtttgccgataacggcatt
ccgctcacactgtttcatggccgaggtggctccatttcccgaggcggatcgcccacccgc
atggcgctgttatcacagccgccgggctcggtggccgggcgtatacgggtgacggagcag
ggggaggtgattcggtttaaatacggtcgcccgtcggtggcggtgtttaacctggagcag
tatgtggcggccactttagaagcaaccttgttgccaccccaggcggcacggccggagtgg
cgccaacagatgcaggccctgacggatacctccgtggcgggctatcgcggggtggtgcgc
gatgagcctgagctggtgcgctacctgcgtaccgttacgccagaaacggagttgtcgcgg
ctagcgctgggcagccgccctgcgcggcgcaagtcggatcaaggtatcagctctctgcgg
gcgatcccttgggtgtttgcttggacccagattcggttaatgctgcctgcctggttaggc
accggcgccgctctggaagatgctcagaacgatgccgcgcagcatgctatggtgcgggaa
atggctagcgagtggccttttttccagggcgtggtggatatgctggagatggtactggcg
aaatcggatttgcgtgtggccgcttggtatgaagagcgtttggcgggggacgatcccggg
ttaatgcgtcttggtgaagtgctgcgcgagcggctcaccgccacggtgagcgccttgtct
gccctcactggtcgagaagacttgctggataacaatccggtgatgcgctggtcgattcgg
gtgcgtgacccttacaccgaccccctgcacctgttgcaggcggagctgatggcaaggctg
cgccaacaggatggcgatgagaccttggagagtgcactgatggtaaccattgcgggtatt
gcagcgggcttacgcaatacaggatag

DBGET integrated database retrieval system