KEGG   Alcanivorax borkumensis: ABO_1154Help
Entry
ABO_1154          CDS       T00380                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00061  Fatty acid biosynthesis
abo00780  Biotin metabolism
abo01100  Metabolic pathways
abo01212  Fatty acid metabolism
Module
abo_M00083  Fatty acid biosynthesis, elongation
abo_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:abo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ABO_1154 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ABO_1154 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abo01004]
    ABO_1154 (fabZ)
Enzymes [BR:abo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ABO_1154 (fabZ)
Lipid biosynthesis proteins [BR:abo01004]
 Fatty acid synthase
  Component type
   ABO_1154 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: CAL16602
UniProt: Q0VQE6
LinkDB All DBs
Position
1312014..1312463
Genome map
AA seq 149 aa AA seqDB search
MEHMMMDIKEVREYLPHRYPFLLIDRVLNIEPGKRIEALKNVTINEPFFNGHFPEEPIMP
GVLIIEAMAQAAGILGFVTENKKPSDGYIYLLVGTDKARFKRQVVPGDTLHLFAEYVVIK
RNIIKFTCEAQVDGKTVASAEMLVAEQKV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttggaacacatgatgatggacattaaagaggtcagggaatatctgccccatcgttacccc
tttctgttaattgaccgggtgctaaatattgagcccggaaaacgtatcgaagcgttaaaa
aacgtgacgatcaacgagccattttttaatggccattttcctgaagagcctatcatgccc
ggtgtgttgatcatcgaagccatggcgcaggctgcaggtattttggggttcgtgacggag
aataaaaagccctccgatggttatatctatctacttgtgggtaccgacaaggcacgcttt
aagcgccaggtagtgccgggagatactctgcatttgttcgccgagtatgtggtgattaaa
cgtaatattataaaattcacctgtgaagcgcaggtagacggtaaaactgtggccagtgca
gaaatgctcgtggctgaacagaaagtctag

DBGET integrated database retrieval system