KEGG   Alcanivorax borkumensis: ABO_1248Help
Entry
ABO_1248          CDS       T00380                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00020  Citrate cycle (TCA cycle)
abo00270  Cysteine and methionine metabolism
abo00620  Pyruvate metabolism
abo00630  Glyoxylate and dicarboxylate metabolism
abo00680  Methane metabolism
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01120  Microbial metabolism in diverse environments
abo01130  Biosynthesis of antibiotics
abo01200  Carbon metabolism
Module
abo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abo_M00012  Glyoxylate cycle
abo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:abo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABO_1248 (mdh)
   00620 Pyruvate metabolism
    ABO_1248 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    ABO_1248 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    ABO_1248 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ABO_1248 (mdh)
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     ABO_1248 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: CAL16696
UniProt: Q0VQ52
LinkDB All DBs
Position
complement(1422348..1423334)
Genome map
AA seq 328 aa AA seqDB search
MFMKAPVRVAVTGAAGQISYSLLFRIASGDMLGKDQPVILQLLEITPALEALNGVIMELE
DCAFPLVAGITGTDDANVAFKDADYALLVGARPRGPGMERKDLLEANAAIFSAQGKAIND
NASKGIKVLVVGNPANTNALIAQRNAPDIDPRQFTAMTRLDHNRAMAQLANKLGKTVNDV
KKMLIWGNHSSTQYPDLHHCEVDGKVAIDQVEQDWYENDYIPTVQQRGAAIIKARGASSA
ASAANAAVDHMRSWALGTDEGDWVSMGIYSDGSYGIQEGLIYSFPCTCKNGDWTIVQGLE
VNDFSRGKMQATEQELAEERDAVSHLLP
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ttgttcatgaaagcacccgtacgcgtagccgtcaccggcgccgctggccaaatcagctat
tccctgctgttccgcatcgcttccggcgacatgcttggcaaagaccagcccgttattctg
caattgctcgaaatcacccctgctctggaagccctgaacggggtcatcatggagctggaa
gattgcgcattcccgctggttgccggtatcaccggtaccgacgatgccaacgtggccttc
aaagacgccgactacgcgctgttggttggtgctcgtccgcgtggtccgggcatggagcgt
aaagatctgctggaagctaacgcagccatcttctccgcccaaggcaaagccatcaacgac
aatgccagcaaaggcatcaaggttcttgttgtcggcaacccggccaacaccaatgccctg
atcgcccaacgcaacgcgcctgacatcgatccccgtcagtttactgccatgacccgccta
gaccacaaccgtgccatggcgcaactggccaacaaattgggcaaaaccgtcaatgacgtg
aagaagatgctcatctggggcaaccactcttccactcagtatcctgatctgcatcactgt
gaagtggatggcaaagtagccattgatcaggtcgagcaagactggtatgaaaacgactac
atcccgactgtacagcagcgtggtgcagcgatcattaaggcccgtggcgcgtcttctgcc
gcgtctgctgctaacgctgccgtggaccacatgcgttcctgggcactgggcaccgacgaa
ggtgactgggtttccatgggcatctacagtgatggttcctacggcattcaggaaggcctg
atctactccttcccttgcacctgcaagaatggcgactggactatcgttcagggcctagag
gtcaatgacttctcccgtggcaaaatgcaagccaccgagcaggaactggccgaagaacgt
gatgctgtttctcacctgctgccgtaa

DBGET integrated database retrieval system