KEGG   Alcanivorax borkumensis: ABO_1497Help
Entry
ABO_1497          CDS       T00380                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00020  Citrate cycle (TCA cycle)
abo00190  Oxidative phosphorylation
abo00650  Butanoate metabolism
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01120  Microbial metabolism in diverse environments
abo01130  Biosynthesis of antibiotics
abo01200  Carbon metabolism
Module
abo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABO_1497 (sdhB)
   00650 Butanoate metabolism
    ABO_1497 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ABO_1497 (sdhB)
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ABO_1497 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     ABO_1497 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: CAL16945
UniProt: Q0VPF3
LinkDB All DBs
Position
complement(1709652..1710368)
Genome map
AA seq 238 aa AA seqDB search
MKVSIYRYNPETDREPSMKEYEVDTQGKDLMVLDILALVKEQDESMSYRRSCREGVCGSD
GMNMNGKNGLACITPLSQVAPGVLEGKKPLILRPLPGLPVIRDLVVDMGMFYSQYEKVQP
YLQNSSPAPAIERLQSPEEREKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQSYR
FLADSRDTVTEERLSKLDDPFSLFRCHGIMNCVSVCPKGLNPTRAIGHIRSMLLERGI
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcagtatctatcgctacaatccggaaacggatcgcgaaccgagtatgaaggaa
tacgaggtcgatacccaaggtaaagacctcatggttctggatatccttgctttggtaaaa
gagcaggatgagtccatgtcttaccgtcgctcctgtcgtgaaggggtatgcggttccgac
ggcatgaacatgaacggcaagaacggtttggcgtgtatcactccgctgtctcaggtggcg
ccaggtgttctggaaggtaagaagccattgatcttgcgcccgttgccgggcctgccggtg
attcgcgacttggtcgtagacatgggcatgttctatagccagtacgaaaaagtgcagccg
tacctgcagaatagctcgccggctccggccattgagcgcctgcagagcccggaagagcgt
gaaaagctggatggtctgtacgagtgtattctctgtgcgtgctgttcaaccagctgtccg
agcttctggtggaacccggataagttcctggggccggctgccttgttgcaaagctatcgc
ttcttggcggatagtcgcgacacggtgaccgaagagcgtctgtctaaactggacgacccc
tttagtctgttccgctgccacggcatcatgaactgcgtcagcgtttgtccgaaaggattg
aacccgacccgggccattggccatatccgctcaatgttgttggagcggggcatctga

DBGET integrated database retrieval system