KEGG   Alcanivorax borkumensis: ABO_2430Help
Entry
ABO_2430          CDS       T00380                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
abo  Alcanivorax borkumensis
Brite
KEGG Orthology (KO) [BR:abo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ABO_2430 (ahpF)
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ABO_2430 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO Thi4 NAD_binding_8 AlaDh_PNT_C Lycopene_cycl NAD_binding_7 FAD_binding_3 K_oxygenase 3HCDH_N Glutaredoxin Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: CAL17878
UniProt: Q0VLS0
LinkDB All DBs
Position
complement(2749791..2751407)
Genome map
AA seq 538 aa AA seqDB search
MLTNEILQALKGYAANMQKKVSFVLQSGSHDKREELVTFLSSIAGVSDNLAFEERDLGDR
LRSPISFLLEADGEDTGIRFSGIPAGHEFNSLVLAFLHASGTEIKLDAGLQRMVAKAKGD
MHFEVFISLSCHNCPDVVQALNQFALLNPNIRTEMIDGGLFQDVVSDRNIQGVPSVYLNG
ELFANGKVTAAELIDKLLAYDPSLAEAGVGEKLPLQDVTVIGGGPAGVSAAIYSARKGLK
VTLIADRIGGQVKDTMDIENLISVKKTTGPELSGALQAHMSEYDVTVKEHLRVARVEKGD
IKTVVLSSGEAIDTKTIIVATGAKWRELGVPGEKENIGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVNVFEFMPELKADKVLVDKAEAKANITIHRNVATNQIMASN
GKVDAIEYIDRDTEQLHRLPLHGVFVQIGLVPNSDFLEGVVERSRFGEIEINEKCQTSQE
GIYAAGDVTTVPYKQIVISMGEGSKASLAAFEYLLTQSDRLDALYENDKDVQKVAAVA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgctcacgaatgaaattttgcaggctcttaagggctacgccgccaacatgcagaagaaa
gtctcttttgtgctgcaaagcggatcccatgacaaacgcgaggaactggtaacgtttctt
tccagtatcgcgggtgtcagtgacaatctcgcgttcgaagaacgggatctgggtgacagg
ctccgtagtccaatcagttttctgttagaagccgatggtgaagacaccggtatccgtttc
tccggtattcccgcaggccatgaattcaattccttggtgttagcgtttctacatgcatct
gggaccgaaattaaactggacgcgggtcttcagcgcatggtggctaaggccaaaggcgac
atgcattttgaagtgtttattagcctgagctgccataactgcccagatgtggttcaggcg
ctgaatcagttcgccttgttgaaccccaatatccgtacggaaatgatcgacggggggttg
tttcaggatgtggtcagtgacaggaacattcagggtgtgcccagcgtttacttgaacggc
gagttgttcgccaatggcaaggttaccgccgctgagttgatcgataagctgttggcctac
gacccaagcctcgctgaagccggtgtcggagaaaaactgccattgcaggacgttaccgtt
atcgggggcggcccggcgggtgtttccgccgcaatttacagcgcccgtaaaggtttgaag
gtcaccctgatcgccgatcgtattggtgggcaggtgaaagacaccatggatatcgaaaac
ctgatctccgtaaagaaaaccaccggcccggaactgtctggtgcgctgcaggcgcatatg
agcgaatacgatgtgacagtaaaagagcatctgagagtggctcgtgtggagaaaggcgat
attaagaccgtggttttgtcttccggtgaagctatcgacaccaagacgattatcgtggcc
accggcgccaagtggcgcgaactgggtgtgcctggtgaaaaggaaaatatcggcaatggt
gtggcttactgcccacactgtgatggtcccttcttcaagggcaaggatgtcgctgtcatt
ggtggtggcaactctggcatcgaagctgcgctggatttggccggtatcgttaaatcagtg
aatgtattcgagttcatgccagagctgaaagcggacaaggtgctggtggacaaggctgaa
gccaaagccaacattaccattcaccggaacgtggcaaccaatcagataatggccagtaac
ggcaaggtagatgccattgaatacattgaccgtgatactgagcaattacatcgactgccc
ttgcatggggtgtttgtgcagatcggactggtgcccaacagtgactttctagaaggggtg
gttgagcgtagtcggtttggagaaattgaaatcaacgagaagtgccagacatcgcaagag
ggaatttatgcggctggtgatgtgaccaccgtgccgtacaaacagattgttattagtatg
ggcgaaggctccaaggcttccctggctgcttttgaatacctgctgacacagagcgatcgt
cttgatgccctgtatgaaaatgacaaggatgtgcagaaggtcgcagcggttgcctga

DBGET integrated database retrieval system