KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT107062Help
Entry
AGABI1DRAFT107062 CDS       T03136                                 

Gene name
AGABI1DRAFT_107062
Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Brite
KEGG Orthology (KO) [BR:abp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:abp03036]
    AGABI1DRAFT107062 (AGABI1DRAFT_107062)
Enzymes [BR:abp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AGABI1DRAFT107062 (AGABI1DRAFT_107062)
Chromosome and associated proteins [BR:abp03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     AGABI1DRAFT107062 (AGABI1DRAFT_107062)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 18822350
NCBI-ProteinID: XP_007330260
JGI: Agabi_varbur_1_107062
UniProt: K5X8X7
LinkDB All DBs
Position
Unknown
AA seq 601 aa AA seqDB search
MPDAAIFLQDACLQHNYIRSKDKSSIVERPERLRAINIGISGALARLESVVAEEPNKREA
DGEINELTDVLGKMRLGTPAGDVGTSIVEIVKSQAEIDLLNHEAVKFIHGDIEGDVYLEN
LKTWAKNSWDEIAEGGSEIPLDLPQGDLYLCPESIDAIQGALGTVCEAVDRIVDDQDPIK
RAFVAVRPPGHHCGEDTPSGFCFVNNVAVAAAHAYLKHKINRIVIFDIDLHHGNGTQSIV
WSINEETYRQTLEAEAGAPEQSRNRLRIYYGSIHDVLSFPCEDGNPALVQAASVSIHKSH
GQYVENIHLQTYESENHFWDVLYKEQYSKLILRAEEFINGTGGPGDDVLVFISCGMDACE
HEYPSMSRHNRKVPTSFYHRFTNDARTFAGEYSSGKLISVLEGGYSDRALISGSLAHVCG
LAGSDKVDEEWWNVENLIELEKATKKRRGGRPSLNNLEPDIIPKWLERTVTIFNSLEQSI
TRASGSSIPAPPSTRTLRDRTKLNQSNSSDNNLGQIEKKAPRKSNDGNTIKKLEASTKVT
KIKRKPRKSKEPVVTSQPEDEGTDSPSSPDLGEQGRPPAQGHKPVTKVILKLGKAPEKVD
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgccagacgccgcaatattcctgcaagacgcgtgtcttcagcacaattacatccgttca
aaagacaaatcaagtattgtagagcgtccagaacgacttcgtgctatcaacatcggcatc
tctggcgcgcttgcacggttggaaagtgtcgtagcagaagaaccaaacaaacgcgaagca
gacggcgagattaacgaattgaccgatgttttgggcaagatgcgtcttggaacacccgct
ggtgatgttggcaccagtatagttgaaattgtgaagagtcaagccgaaattgatcttttg
aaccacgaagccgtcaaatttatacacggagacattgaaggggacgtctatctggagaat
ttgaagacttgggcaaagaatagctgggacgaaattgcggaaggcggctcggaaatacct
ctggacctacctcaaggcgatttgtacctatgcccagagtcaatcgacgcgattcagggg
gcactcgggacagtgtgcgaggctgttgatagaatcgtagatgaccaagatccgatcaaa
cgcgcttttgtcgcagttcgaccaccaggacatcactgcggggaagatactccttcaggt
ttttgtttcgtcaacaatgtcgcggttgctgccgcacatgcgtatcttaaacacaagatc
aatcggatagttatattcgacattgatctccaccacggaaatggcacgcaatcgatcgtc
tggtccatcaacgaggaaacctatcgccaaacgctcgaagctgaggcgggtgcaccagaa
caatctaggaaccgtcttagaatatactatggatctattcatgatgttttgtcctttccc
tgtgaggacggtaatccagcattggttcaagcggcttctgtttctattcataagtctcat
ggtcaatacgtggagaacattcacctacagacgtacgaatcagaaaaccatttttgggac
gtcctatataaggagcaatactccaaattgattctccgtgccgaagagttcataaatgga
actggcggacctggggacgatgtcttggtctttatcagttgtggaatggatgcttgcgaa
catgagtatccctcgatgtctagacacaatcgcaaggtgcctacatccttctaccatcgt
ttcaccaatgatgctcgtacattcgcgggagaatattcttcaggaaagcttatcagcgtt
ttggaagggggatacagtgatagagcgttgatcagtggcagtctggcacatgtatgcggc
ctggcaggatcggacaaagtggacgaagagtggtggaatgttgaaaacctaatcgagctt
gaaaaggctaccaagaaacgacgtggaggtagaccatccttaaacaatctcgagcccgat
attattccgaaatggctggaacgcaccgtgacgatctttaattctctggaacaatccatt
acccgcgcgtctggaagttcgattccggcacctccctcaacccgtacactccgcgatcga
acgaagctcaatcaatcaaacagtagcgataacaatctggggcagatagagaagaaggca
ccccgaaagtcgaatgatgggaatacaatcaagaagctcgaggcttcaactaaagtcacc
aaaattaaacgaaaaccccggaaatcgaaagaacctgtggtcacgtcacagccggaggat
gagggaacagactctccatcctcaccagacttgggcgagcaggggagacctcctgcacaa
ggtcataaaccagttaccaaagttatcttgaaacttgggaaagctcccgagaaggtcgat
gaatga

DBGET integrated database retrieval system