KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT111257Help
Entry
AGABI1DRAFT111257 CDS       T03136                                 

Gene name
AGABI1DRAFT_111257
Definition
(RefSeq) hypothetical protein
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    AGABI1DRAFT111257 (AGABI1DRAFT_111257)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:abp01003]
    AGABI1DRAFT111257 (AGABI1DRAFT_111257)
Enzymes [BR:abp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     AGABI1DRAFT111257 (AGABI1DRAFT_111257)
Glycosyltransferases [BR:abp01003]
 Glycan extension
  Yeast mannan chain
   AGABI1DRAFT111257 (AGABI1DRAFT_111257)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15 F-actin_cap_A
Motif
Other DBs
NCBI-GeneID: 18823228
NCBI-ProteinID: XP_007326625
JGI: Agabi_varbur_1_111257
UniProt: K5X4C4
LinkDB All DBs
Position
Unknown
AA seq 381 aa AA seqDB search
MMTTMRYVLLVLVIIISLHYILSFSNETYGEVTSLNHVKQIIGVGNEPPYKTAISEEYYI
KPNVSVAEGRRANAAIVILARNSDIDGVVDSVKQMEDRFNKKFRYDYVLLNEQPFEDKFK
YRLEQLTDSTIKYGLIPPEHWVQPEWIDEEKASAARKDMVKNNVIYGGSVPYRNMCRFNS
GFFYRQEILKPYKYYWRVEPGVKFFCDIDYDPFIFMEDKKKVYGFTISLFEYKETIPTLW
NTVKDFIKQNPDFVAPGNSMQFLSDNNGEDYNLCHFWSNFEIGDLDFWRGEAYSKFFDHL
DKAGGFYYERWGDAPVHSIGAALFAQKEQIHFFNDIGYRHEPFQHCPQGSAHKQGKCWCD
EKVNFDYEWYSCLKRYDEMFA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgaccatgcgatacgtcctcttggtcctggtcataatcatcagtcttcactat
atcctgagtttctcgaatgaaacatatggagaggtgacgtccttgaaccacgtcaaacaa
attataggtgtaggaaatgagccaccgtacaaaactgcaatctccgaagagtattatatc
aaacccaatgtatctgtagcggaggggcggagggcgaatgctgccattgtcatacttgct
cggaactctgatattgatggagttgtcgacagtgttaagcaaatggaggacagattcaac
aagaagtttagatatgactatgtgttgctcaatgagcaacctttcgaggataaatttaag
taccgactcgagcaattaacggattctacaataaaatatggccttattcctcctgagcat
tgggtccagccggaatggattgacgaggagaaggcatccgcagcaaggaaagacatggta
aagaataatgtaatctacggaggcagtgtcccatatcggaacatgtgtcgcttcaactcg
ggatttttctatagacaagaaattctcaagccgtacaaatattactggagggttgaaccc
ggcgtcaagtttttctgtgatattgactatgatccattcattttcatggaagacaaaaaa
aaagtttacggatttacaatctcacttttcgaatacaaggaaacaataccaacgctctgg
aacaccgtcaaagatttcatcaaacaaaatccagacttcgtagcgcccggaaactcgatg
caattcttgtctgataacaacggcgaggattacaatctctgccatttctggagcaacttt
gaaattggtgacctggacttttggaggggagaggcgtattccaagttctttgatcatttg
gataaagctggtggattctattacgagcgttggggtgatgctcctgtccatagcattggt
gctgccttatttgcacagaaggaacagattcactttttcaatgatatcggctatcgtcac
gagcctttccaacattgccctcaaggcagtgcccacaagcaaggtaaatgctggtgtgac
gagaaagtgaactttgactatgagtggtactcttgcctgaagcgctacgacgaaatgttt
gcataa

DBGET integrated database retrieval system