KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT111304Help
Entry
AGABI1DRAFT111304 CDS       T03136                                 

Gene name
SDH1, AGABI1DRAFT_111304
Definition
(RefSeq) SDH1 minor succinate dehydrogenase isozyme
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00020  Citrate cycle (TCA cycle)
abp00190  Oxidative phosphorylation
abp01100  Metabolic pathways
abp01110  Biosynthesis of secondary metabolites
abp01130  Biosynthesis of antibiotics
abp01200  Carbon metabolism
Module
abp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abp_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGABI1DRAFT111304 (SDH1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AGABI1DRAFT111304 (SDH1)
Enzymes [BR:abp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AGABI1DRAFT111304 (SDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 18823243
NCBI-ProteinID: XP_007326665
JGI: Agabi_varbur_1_111304
UniProt: K5XHH6
LinkDB All DBs
Position
Unknown
AA seq 625 aa AA seqDB search
MLSRALSRAHRPFLATKAAVRTQSSWSSGKYPLIEHEYDAVVVGAGGAGLRAAFGLAEAG
FKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCR
EAPNTVIELEHYGVPFSRTKEGKIYQRAFGGQSLKFGKGGQAYRCAAAADRTGHALLHTL
YGQSLRHDTNFFIEYFALDLIMQDGECVGVIALNMEDGTLHRFRSHKTVLATGGYGRAYF
SCTSAHTCSGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGE
RFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEKDHIYLQLSHLPPDILHERLPGIS
ETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTRYTGEVITVDENGQDKIVPGLYAAGEAAS
VSVHGANRLGANSLLDIVVFGRAAAHHIRDTLTPGKPHKDIPQEAGLESIEFLDKIRQSD
GPEPTAKIRLDMQKAMQTDAAVFRTQETLDEGVAKMRQIYNNFEKVGIKDRSMIWNSDLV
ETLELRNILQNAIQTITAAAARKESRGAHAREDYPERDDATWMKHTLSFQPDISTPDVVL
KYRKVIDKTLDENECKPVPPFKRVY
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgctctccagagccctctcccgcgcacatcgcccattcctcgccacaaaagcagccgtc
aggacacagtcctcctggtcttccggcaagtatcccctcatcgagcacgagtacgatgcc
gtcgttgttggtgcaggtggtgccggcctgagggctgcctttggtctcgctgaggctggt
ttcaagactgcctgtatcaccaaactctttcccaccagaagccatactgtcgctgcccag
gggggtatcaatgctgcgcttggtaacatgacagaagacgactggagatggcatatgtat
gatactgtcaaaggctctgactggctcggtgaccaggatgccatccactacatgtgccgg
gaggctcccaacaccgttatcgagctggagcattatggtgttccgttttcacggaccaag
gagggcaagatctatcaacgcgcctttggtggtcagtccctcaaatttggcaagggtggt
caagcctatcgctgcgctgctgctgccgatcgtactggtcatgctctcctccatactctt
tatggccaatcacttcgccatgacaccaactttttcattgaatatttcgctcttgacctc
attatgcaagacggcgaatgtgtcggcgttattgctctgaatatggaggacggtacactt
catcgcttccgcagtcacaaaactgtccttgctactggaggttacggacgtgcgtacttc
agctgtaccagtgctcacacatgttcgggagacggtaatgccatggttgcacgtgccggt
cttcctctacaagatctggaattcgtccagttccacccaaccggtatctacggtgctggt
tgcttgatcacagaaggttcgcgcggtgaaggaggttatcttctcaactctgagggtgag
cgtttcatggagcgatatgcccccactgccaaggatcttgcatctcgtgacgtcgtttct
cgatccatgacacttgaaatccgtgagggccgtggtgttggtcccgagaaagaccatatc
tacctccaactcagtcatttgcctcccgacattcttcacgagaggcttcctggtatttct
gaaacggccgctattttctctggtgtcgatgtcaccaaggagcccattcctgttctccct
actgtccactacaacatgggtggtattcccaccaggtacactggcgaggtcatcaccgtt
gatgagaacggccaagacaagatcgtccctggtctctatgctgctggcgaggctgcttcc
gtctctgtccatggtgctaaccgtctcggagccaactcacttcttgatatcgttgtattc
ggtcgcgctgctgctcatcacatccgcgacacccttactccgggcaagccacacaaggat
attcctcaagaggccggtcttgaaagtatcgagtttttagacaagatcagacaatcggat
ggtccagagcccaccgccaagattcgtcttgacatgcaaaaggccatgcaaactgatgct
gctgtcttcaggactcaggagactcttgatgaaggtgttgccaagatgcgtcaaatctac
aacaactttgaaaaggtcggaatcaaggacaggagcatgatttggaactcagatctggtg
gaaactttggaactccgtaatattctacaaaatgccatccaaactatcactgctgctgct
gctcgcaaggagtcccgcggagcacacgctcgggaggattaccccgaacgtgacgacgca
acctggatgaaacacacgctttctttccaacctgatatcagcacccctgatgtggtcctc
aagtatcgtaaggtcatcgacaagaccctcgatgagaacgagtgcaagcctgttcctcct
ttcaagcgtgtctactag

DBGET integrated database retrieval system