KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT112487Help
Entry
AGABI1DRAFT112487 CDS       T03136                                 

Gene name
AGABI1DRAFT_112487
Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00500  Starch and sucrose metabolism
abp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AGABI1DRAFT112487 (AGABI1DRAFT_112487)
Enzymes [BR:abp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AGABI1DRAFT112487 (AGABI1DRAFT_112487)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 18823660
NCBI-ProteinID: XP_007328358
JGI: Agabi_varbur_1_112487
UniProt: K5XZA3
LinkDB All DBs
Position
Unknown
AA seq 574 aa AA seqDB search
MRISSAFLWTSLALSWGTYAQSSSVDAYLAAESPIAKAGLLANIGPSGSKSAGAKAGIVI
ASPSHSDPDYLFTWTRDASLVFAVIIDQYTLGLDTSLRSHIDDFVSSQKIIQQVSNPSGT
ISTGGLGEPKFNIDETAFTGSWGRPQRDGPALRANALITWSNHLLKQNNASYVTSTLWPI
IKLDLDYIKNTWNQSSFDLWEEVSSSSFFTTAVQHRSLRQGAALANAIRETSVVADYTKQ
ADNLLCFMQSYWNTAGYMTANTGGGRTGKDANTVLASIHTFDAAAGCDAATFQPCSDRAL
ANLVAYVNAFRSIYAINSGVPSNVGIATGRYAEDVYFGGNPWYLTTLAVAEQLYDALIVW
KNQGSITVTNLSKPFFSLFSSGISTGTFSSSSSTFNTLITGVQNYADSFVNVVAKHTPSG
GGLAEQYSRNDGNPLSAFDLTWSYASLLTADGARNGVVPASWGAKGLTVPGTCSGNSGPT
AHVTFNVNAETVFGENIFVTGSVGALANWSPDNAIALNADNYPIWSVAIDIPASTNVEYK
YIRKFNGGVTWESDPNRRFTSPASGSSTLNDVWR
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatttcttcagcattcctctggactagtttggcgctctcatggggaacctatgca
cagtccagttctgttgatgcatatttagccgctgaatctccgatagccaaggctggtcta
cttgccaacattggaccttctggttccaagtcagcgggtgctaaagcaggaatagtgatc
gcctctccatcacattcggaccctgactatctgtttacctggactcgtgatgcctcgctc
gtgtttgcggtaatcattgaccaatacacgttgggcctggatacttctctgcgaagtcat
atcgatgattttgtttcctcacaaaaaattatacaacaagtgtctaatccttcgggaacg
attagtaccggtggcctcggtgaaccaaagttcaacatcgatgaaacggctttcactggt
tcatggggtcgtcctcaacgagatggtcctgccctaagagccaatgctctcatcacctgg
tcgaaccaccttcttaaacaaaataacgcgtcctatgtcactagcacattgtggcccatc
atcaagctcgacctcgactacataaaaaatacctggaatcagtctagtttcgacttgtgg
gaagaagtgtcatcctcgtctttcttcaccaccgctgtgcaacaccgttcactccgccaa
ggcgcagcattggccaatgcaatccgcgaaacttctgtcgtggccgattatacaaaacaa
gcggacaaccttctgtgcttcatgcagtcatactggaatacagcaggttatatgactgca
aacacgggtggtggtcgtacaggtaaagatgcaaatactgttctcgctagtatccacacc
ttcgatgctgctgctggttgcgacgctgccactttccaaccttgctctgaccgtgccctg
gctaatctcgtcgcatatgttaacgccttccgaagtatttatgccatcaactcgggcgtt
ccatcaaatgtcggtatcgcgactggaagatatgcagaggatgtgtatttcggtgggaat
ccatggtacctgacgactttggcggttgcggaacagctctatgatgctttgatcgtctgg
aaaaaccaaggttcaatcacagtcacgaatctatccaagccattcttttcactcttctcg
tctggcatttctaccggcactttttcttcttcttccagcaccttcaatactctgattaca
ggagtccaaaactatgccgatagtttcgtgaatgtcgttgcgaagcatacaccctctggt
ggaggccttgctgagcagtacagccgcaatgacgggaatcctctcagtgcattcgatttg
acttggagctatgcttccctcttgacggctgatggtgccagaaatggtgttgttcctgcg
agttggggagccaaagggcttaccgtgcccggaacttgctcagggaacagtggacccact
gctcatgtcacttttaatgttaatgctgaaacggtattcggagagaatatctttgtgact
ggctccgttggcgctttggcaaactggtctcctgataacgcaattgctctcaatgcagat
aattatcccatttggagtgtggctattgacatcccagcaagcacgaatgtagaatataaa
tatattcgcaagttcaacggcggagttacctgggaatcggaccctaatagacggttcacg
tctccagcaagtgggagctctaccctcaacgatgtttggcgatag

DBGET integrated database retrieval system