KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT112852Help
Entry
AGABI1DRAFT112852 CDS       T03136                                 

Gene name
AGABI1DRAFT_112852
Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AGABI1DRAFT112852 (AGABI1DRAFT_112852)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abp02000]
    AGABI1DRAFT112852 (AGABI1DRAFT_112852)
Enzymes [BR:abp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AGABI1DRAFT112852 (AGABI1DRAFT_112852)
Transporters [BR:abp02000]
 Other Transporters
  Pores ion channels [TC:1]
   AGABI1DRAFT112852 (AGABI1DRAFT_112852)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C GST_N_4
Motif
Other DBs
NCBI-GeneID: 18823793
NCBI-ProteinID: XP_007328644
JGI: Agabi_varbur_1_112852
UniProt: K5XCX0
LinkDB All DBs
Position
Unknown
AA seq 256 aa AA seqDB search
MSIPDAQIHPVATGAASETVAKHQDPQEITLWSGWFCPFVQRIWIALEERGIPYQYKEVN
PYKKEKHFLDINPKGLVPAVEYKGKALYESLVLLEFLEEAYPTVKPSLLPTEPYDRAVAR
IWVDHITKNYLPAFHRLMQSQEPEVQEQARKDLIEAQKKLVAQVKGPYFFGEQFGIVDVA
VAPWIVRDWVISENRGYSRSQAGEAWAKYAKAVTERPSLLKTESDKEHYGQIYGRYLRNE
AQSEAAKAIRAGKQIP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcccagacgcacaaatccatcccgtcgcgacgggtgctgcgagtgaaacggta
gcgaaacatcaggatcctcaagaaattacactctggtctggttggttttgtcccttcgtc
caaaggatttggatcgctcttgaggagaggggaattccgtaccagtacaaagaagtcaat
ccttataagaaggagaaacatttccttgatatcaaccccaaaggtctcgtacccgctgtc
gaatacaaagggaaggcactatatgaatcactcgtccttctggaattcttggaggaagcc
tatcctacggtcaagcccagtctactcccgacggaaccatacgatcgggctgtggctcga
atttgggtggatcatatcaccaagaattaccttccggcattccatcgacttatgcaatcg
caagaaccggaagttcaggaacaggcacgcaaagatttaattgaggctcaaaagaagctg
gtggcacaagttaaaggtccatacttcttcggggagcaattcggaattgttgacgttgct
gtggcgccttggattgtaagagactgggttatcagcgagaacagaggatatagtaggagt
caagctggagaagcttgggcgaaatatgccaaggcggtaactgagagaccaagtctgttg
aaaacggagagcgataaggaacattatggtcagatatatgggcgttatctaaggaatgaa
gctcagagtgaggctgcaaaggcaattagagccggaaagcagattccttaa

DBGET integrated database retrieval system