KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT113697Help
Entry
AGABI1DRAFT113697 CDS       T03136                                 

Gene name
AGABI1DRAFT_113697
Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00020  Citrate cycle (TCA cycle)
abp00310  Lysine degradation
abp00380  Tryptophan metabolism
abp01100  Metabolic pathways
abp01110  Biosynthesis of secondary metabolites
abp01130  Biosynthesis of antibiotics
abp01200  Carbon metabolism
Module
abp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGABI1DRAFT113697 (AGABI1DRAFT_113697)
  Amino acid metabolism
   00310 Lysine degradation
    AGABI1DRAFT113697 (AGABI1DRAFT_113697)
   00380 Tryptophan metabolism
    AGABI1DRAFT113697 (AGABI1DRAFT_113697)
Enzymes [BR:abp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AGABI1DRAFT113697 (AGABI1DRAFT_113697)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 18824081
NCBI-ProteinID: XP_007329833
JGI: Agabi_varbur_1_113697
UniProt: K5WUG8
LinkDB All DBs
Position
Unknown
AA seq 1012 aa AA seqDB search
MLSRRVVVGRLSTLARASRSLRPTPPPLIRRGYALARGPSHNDPFANGTNAYYADEMYRL
WRQDPKSVHTSWDVYFSGLDQGMPSHHAFQPPPTTHLPHPADGAPALHAGDGAELNDHLK
VQLLVRAYQVRGHHVAELDPLGILDTDLADVRPPELELSRYGFTERDLEKDITLGPGILP
HFATEGNKTMKLKDIIRTLKRIYCGHVGIQYVHIPDKEQCDWIRERVETPKPWNYTVEEK
RMILDRLIWSESFEKFMASKYPNEKRFGLEGCEALVPGMKALIDRSVETGVKHITMGMPH
RGRLNVLANVIRKPIEAILNEFSGDEDDNWPAGDVKYHLGANYVRPTPSGKKVSLSLVAN
PSHLEAADPVVLGKTRAIQHFENDEIAHTTAMGVLLHGDASFAGQGVVYETMGLHSLPSY
GTGGTIHLIVNNQIGFTTDPRFARSTPYPSDIAKSIDAPIFHVNGDNVEAVNFVCQLAAD
YRAKFKKDVVIDIVCYRRYGHNETDQPSFTQPRMYEAIKNQPTPLTKYTKFLVGRGTFTE
KDIEEHKKWVWGMLETAANGAKDYVPTSKEWLSAAWTGFPSPRQLAEQALPTRATGSDVP
TLRQIGKAISTFPQGFTTHRNLARILNARGKTVEEGTNIDWSTAEALAFGTLALEKIHVR
LSGQDVERGTFSQRHAVIHDQANEQQYVPLNDLGSNQARFVVCNSSLSEFGTLGFELGYS
LVSPDSLTIWEAQFGDFANNAQCIIDQFIAAGERKWLQRTGLVVSLPHGYDGQGPEHSSG
RIERFLQLCDDHPHIYPSPEKIERQHQDCNMQVVYPTTPANYFHVLRRQIHRDFRKPLIV
FFSKSLLRHPKARSSLDEMVGETHFERYIPEASEDLVAPDQVKRHILCSGQVYYALLQAR
EERGIKDVAISRIEQLSPFPYDMVTSHLDKYPNADLLWCQEEPMNNGAWTYIGPRIYTAA
SRTQNHKGKYPYYAGREPTSSVATGSKTQHKKETEAFVNTAFDTWTEMHHLK
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgctctccaggcgcgtcgtcgtcggtcgtctctcgaccctcgcccgcgcgtccaggtcg
ctccgacccacaccgccgccgctgatccgtcgggggtacgctctcgcacgtggaccctcg
cacaacgacccctttgcgaacggcaccaacgcctactatgcagacgagatgtaccgtctg
tggaggcaggacccgaagtctgttcatacatcttgggacgtatacttttccggtctcgac
caggggatgcctagccaccatgctttccaacctcctccgaccactcatctaccccaccca
gctgacggtgcacccgctctacatgccggcgacggcgcagaactgaatgaccatctcaag
gtccaactcctcgtacgggcgtatcaagtacgcggacatcatgtcgccgaattggatcct
ttgggcatcttggatacggatttggctgacgttcgccctcctgagctcgaactcagccgt
tatggttttactgaacgtgacctcgagaaggatatcacccttggtccaggtattcttccc
cattttgctaccgaagggaacaagacgatgaagttgaaggacatcatcagaacccttaag
aggatctattgtggacatgtgggtatccagtatgtgcatatccccgataaggagcaatgc
gactggatcagggaacgtgtcgagacccccaagccatggaattataccgtcgaggagaag
cgtatgattttggaccgacttatctggtccgaatctttcgagaaattcatggcgagcaag
tatcctaatgaaaaacgttttggtcttgaaggctgtgaggccctcgttcccggtatgaaa
gccctcattgaccgttccgtcgaaacgggtgtcaagcatatcactatgggtatgccacac
cgtggtcgtctcaatgtcctcgccaacgtcattcgaaagccgatcgaggctattctcaat
gagttttctggtgacgaagatgataactggcccgccggtgatgtcaaatatcacctgggt
gccaactatgtccgtcccacaccttcgggcaagaaagtctccctctcacttgttgccaat
ccctcgcatttggaagctgccgaccctgttgtgttgggcaagacccgtgccatccagcac
tttgaaaacgatgagattgcccacaccacagctatgggagtcctccttcatggtgacgct
tcatttgcaggacagggcgtcgtttacgagaccatgggactccatagcttgcctagctat
ggaaccggaggtactatccacctaatcgtcaacaaccaaattggtttcactacggatcct
cgtttcgcgcgttctacgccttatccctccgatattgccaaatccattgatgcccccatc
ttccacgtaaacggcgacaatgtcgaggctgtcaactttgtctgccagcttgcggctgat
taccgtgccaagttcaagaaggatgttgtcattgatattgtctgctaccgtagatatggt
cacaatgaaactgatcaaccaagtttcacccagccaaggatgtacgaagccatcaagaat
cagcctactcctttgaccaagtacaccaaattccttgtcggccgtggcaccttcacggag
aaggatattgaagaacacaagaagtgggtgtggggtatgctagaaaccgctgcgaatggc
gccaaagactacgtacccaccagtaaagagtggttgtctgccgcctggaccggtttccct
tcgcccaggcagctcgcggaacaagcgcttcctactcgtgctaccggatctgatgtcccg
acgcttcggcagatcggcaaagctatttccactttcccccaaggattcactactcaccgt
aaccttgcacgtatccttaatgcgcgtggcaagactgttgaggagggtaccaacatcgac
tggtcaacggccgaggctcttgcctttggtacccttgcattggaaaagatccatgttcgt
ctgtctggtcaagatgttgaacgtggaactttctcgcaacggcacgctgttatccacgat
caggcgaatgagcaacaatatgttcctcttaatgaccttggttcgaaccaagcgcgtttc
gttgtctgcaactcctccttgtctgagtttggtaccctcggtttcgaacttggttactcc
ctcgtatcaccagactcgcttaccatctgggaggctcaatttggtgactttgccaacaat
gcgcaatgtatcattgatcagtttattgctgcgggtgaacggaaatggctccaacgcact
ggtttggtcgtcagcctgcctcacggttatgatggccaaggcccagaacactctagcgga
aggatagaacgattccttcaactttgtgatgaccacccacatatctacccctcgccagaa
aagattgaacgtcaacatcaagattgtaatatgcaggttgtctatccaacaacccctgcc
aactatttccatgttctccgccgtcagatccatcgtgacttccgtaaacctcttatcgtc
ttcttctcgaagagtctgttgcgccatcccaaggctcgctcgtcactcgatgagatggtt
ggtgaaacacactttgaacgctatattccagaagcttcggaggacttggttgcccccgat
caagtgaaacgccacatcctctgctcaggtcaggtgtactatgcacttcttcaagctcgt
gaggagcgtggcatcaaggacgttgccatcagtcgcattgaacagctctcgcccttcccg
tatgacatggtcacttcccacctcgataaataccccaatgctgatctcctttggtgtcaa
gaggagcccatgaacaacggcgcttggacttatattggaccccgcatttacaccgctgct
agcaggactcagaaccacaaagggaagtatccgtactatgctggtcgtgagcccactagc
tccgttgcgacaggtagcaagacgcaacacaaaaaggagactgaggcatttgtcaacacc
gctttcgatacctggacggagatgcaccatcttaaatag

DBGET integrated database retrieval system