KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT116163Help
Entry
AGABI1DRAFT116163 CDS       T03136                                 

Gene name
AGABI1DRAFT_116163
Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00250  Alanine, aspartate and glutamate metabolism
abp00410  beta-Alanine metabolism
abp00430  Taurine and hypotaurine metabolism
abp00650  Butanoate metabolism
abp01100  Metabolic pathways
abp01110  Biosynthesis of secondary metabolites
Module
abp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AGABI1DRAFT116163 (AGABI1DRAFT_116163)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AGABI1DRAFT116163 (AGABI1DRAFT_116163)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AGABI1DRAFT116163 (AGABI1DRAFT_116163)
   00430 Taurine and hypotaurine metabolism
    AGABI1DRAFT116163 (AGABI1DRAFT_116163)
Enzymes [BR:abp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AGABI1DRAFT116163 (AGABI1DRAFT_116163)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC dCache_3 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 18824992
NCBI-ProteinID: XP_007333568
JGI: Agabi_varbur_1_116163
UniProt: K5VN05
LinkDB All DBs
Position
Unknown
AA seq 533 aa AA seqDB search
MSLSRHINAEEIIEKSKDHPQIKFANAARRHGPANTSHWNRDEDVAGLSKYTIPPKGVSS
RSAYQLLHDEMALDGNPTLNLASFVHTYMPEEATKLMVENISKNIVDQEEYPAAQLIHNR
CISMIADLWKAPKDAKPIGTATAGSSEAIMLGGLAMKKRWQEARKAAGKDYFHPNIVFGS
NAQVALEKFARYFDVECRLVPVTEEHDFVMNPHDALQYIDENTIGVMVILGSTYTGHFEN
VQLMSDLLDNLQQRTGLDIPIHVDAASGGFFAPFAYPHLKWSFEIPRVVSINASGHKFGL
VYVGIGWVLWRDESLLHKDLIFELHYLGSTEYSFTLNFSKPAAPIIGQMFNFLNLGVDGF
KRIAVKDLRNARMLSRALNGTYFKVLSSIHLPVHEDRGDDVPEHYRSGLPVVSFRLSDEF
KKANPQVEQKWIQTLLKTKGWIVPNYNAPEGTEDVEILRVVVRESVSEDLVERLIVDIVE
ITESLQGSEGNLMATTSNSAVHHPEKHHGRPDPENFGKSHKPAKKQAGFSRQC
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttctagacacatcaacgccgaagaaatcatcgaaaagtccaaggatcatccg
cagataaagtttgctaacgctgctagacgtcatggccctgccaatacctctcactggaat
cgcgacgaggatgttgcgggactctccaagtataccattcccccgaaaggagtctcgtct
agatcagcataccagcttctccacgacgagatggctctggatggtaacccaactctgaac
ttggcgtccttcgtacacacatatatgcctgaggaggctacaaagttgatggttgagaac
atcagcaaaaacatagttgatcaagaggaatacccggccgctcaactaattcacaaccgc
tgcatttcaatgattgcggatctgtggaaggcaccgaaggacgccaagcccatcggaacg
gccactgctggctcttcggaagctataatgctaggtggattggctatgaaaaaacgttgg
caagaagcgcgtaaggctgctggaaaggactacttccatcccaacatcgtattcggttcg
aacgctcaagttgctcttgagaaattcgcacggtacttcgacgtcgaatgtcgtttggtt
ccagtcacagaagaacatgatttcgtgatgaatcctcacgatgctttgcaatacattgat
gagaataccatcggtgtcatggtcattcttgggagcacctacactggccatttcgaaaat
gttcaactcatgagcgacctattggacaatcttcaacagcgtactggccttgatattccc
attcatgttgatgctgcttctggtggattctttgcgcctttcgcttatccgcacctcaaa
tggtctttcgaaattccgcgagtagtttctattaacgcctctggtcataaatttggtctg
gtttatgtcggaatcggctgggttctctggcgtgatgagagcttattgcataaagatttg
atttttgaacttcattaccttggtagcacagaatactcatttactctgaacttctccaaa
ccggccgctccgattattggacagatgttcaatttcctgaatcttggagttgatggcttc
aaacgaattgctgtcaaggacctgcgtaacgctcgaatgctatctcgtgcactcaatgga
acctatttcaaagtcttgagcagcattcatctaccagttcatgaggaccgtggagacgac
gttccggagcactacagatccggcctgcctgtggtttcctttagattgtctgatgagttc
aaaaaggcaaatcctcaagtggagcaaaagtggatccagactttactgaaaactaagggc
tggatcgttcctaactacaatgctcccgaaggcacagaagatgttgagatcttgcgcgtc
gttgtccgcgaaagtgtaagcgaagacttggtcgaacgccttattgtagatatcgttgaa
atcactgaatctcttcaaggctcggagggtaatctgatggcgacgacatccaattcggcc
gttcaccatcccgagaagcaccatggccgacccgatcccgaaaacttcggcaagtctcat
aaacctgccaagaagcaagctggtttctccaggcaatgttga

DBGET integrated database retrieval system