KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT126609Help
Entry
AGABI1DRAFT126609 CDS       T03136                                 

Gene name
AGABI1DRAFT_126609
Definition
(RefSeq) hypothetical protein
  KO
K11274  chromosome transmission fidelity protein 4
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Brite
KEGG Orthology (KO) [BR:abp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:abp03036]
    AGABI1DRAFT126609 (AGABI1DRAFT_126609)
Chromosome and associated proteins [BR:abp03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    AGABI1DRAFT126609 (AGABI1DRAFT_126609)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 18826544
NCBI-ProteinID: XP_007328220
JGI: Agabi_varbur_1_126609
UniProt: K5W176
LinkDB All DBs
Position
Unknown
AA seq 1137 aa AA seqDB search
MAVVSNPAHPDGHTCLAFSPDGAFIYTGGTDYLVRIWSIDNDGTNEPESATDAEHEISSL
SISHDFWLSASDDLVRRYVKHDTQLHGFVTNTNGVRIRSVAIDPKGKNIAVASDELFIKL
IDAEDTTDVQQLQGHTKGVRQVSWDPTSNFLTSCGSDGKILVWNTSAAETTLEATIEGVL
PIITDQESNEFLLHDCSAVWHPSGKCFYVVSRSHEIVSVNKSTWTKDSTFIDKDITGAIT
ALAISPNGLYLASACQSNVYIWSTDSQRVVTRHIARLGGTVVTALSWCPTKNHLAWTDGN
GEFFQWQKPISDGQPDPVKVINSSTTAKPRADLDLFGEEPLDTGTSALALDQNIDAEVEA
EDDYDNWIVDDLGGGMQDEPTAGPKASDGYVKEMVSITKAQPAFQPGSTPMVNKKCFMAY
NLIGVIEATDQDTYQIINVEFFDHSTRKNFHFTDHFKHNLGYLGERGAVFACPPEGEHPA
QVLFRPYGNMSTPRKEWTYQLKRKDSRILGVAAGGLSPSSSLRETTDSDLQGYGDVAVAT
SEGDLTFLTGTGRERRIMGLGGDFVSMVASSEWLFVVYRAGSTTIDGSQNLSYCIINFDD
FSVRQRGILPLPKGHTLKWIGLTDQNAPVTYDTTGCIHVLTKFRIPHHASWARILDTNLL
ERKQGKDESYWPVGMSENTFHCLILKGRQEYPAFPKPLIQELPIILPFRRDEPKEEMIER
QLLYVQTSLDLLDEELTTEDIVSRERNIDKELILLIQAACKSDDAPRVIELVKLLHLLPS
FDAAIKIAGFYHLLGLQEKLEVLKSEREEAEDRLEVLREKRKRWLKTTKRNGGGRRYDPL
GDTGPPPMIQRPGMSRVEKPIVERTRFSSIAPTTQTQTVRDDSSMTMTRSPSPSPWDNDT
ELGGGAVSLNGNDDYNTLGAGGEELGFGTMTGLGGTAQKRKRNDDMEDVGVSQVSDVSIM
PPPPKQKTNPFARKNNTSESNTTRNPFSLRPKPSTILNGGGGITGRGSIQKSDSFFDKVE
AAADNGKKSITKKSSSKSTTKDKSSASASGNNGPKQTTLFGMMPRAFQTSQAPKKPSEEI
SKKQGHIDDGEEMGEETQELLGSCPPDIADMGASESQMTLMDSRGLEETQLDETQVD
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgtctccaacccagcccacccagacggccacacctgccttgccttttccccg
gacggcgcgttcatctatactggcggcacagactacctcgtccgtatatggtctatcgac
aacgacggcaccaacgaacctgaatcagccaccgacgccgagcacgaaatctcctccctt
tccatctcacatgacttttggctctccgccagcgacgacctcgtccgaagatacgtgaaa
cacgatactcagctacatggtttcgtcacaaacacaaacggtgttcgcatccgttccgtt
gctattgatcccaaagggaaaaacattgcggtagcctcagacgaattgtttatcaaactc
atagacgcagaagacaccaccgacgtccagcagctccaaggccacaccaaaggcgttaga
caggtatcgtgggaccccacaagcaatttcttgacttcctgcggttctgacggaaaaatc
ttggtttggaatacctcggctgcagaaactactctcgaggccactatcgagggtgtcctt
cccattataacggatcaagaatcaaatgagttcttgctgcatgattgctctgccgtctgg
cacccgtctggaaaatgcttttatgtcgtttcccggtcgcacgaaatagtctcggtaaac
aagtctacttggacaaaagattcgacttttatcgataaagatatcacgggtgcaatcaca
gcgctcgccatctcacccaacggcctttatctcgcttcggcatgtcagtcaaatgtatac
atttggtcgacagatagccagcgcgttgtcacacggcatattgccagactaggcggaacg
gtagtcactgctttatcatggtgtcccaccaaaaatcacttggcatggacagacggcaat
ggagaattcttccagtggcagaaaccgatttctgatggacaacctgatcctgtcaaagtc
attaactcatctacaacggcaaaaccgagggcagatctcgacttgttcggcgaagaaccc
ctcgatacagggacatcagccttagcactagaccaaaatattgatgcagaagtggaagcc
gaagatgactatgataattggattgtcgatgatctcggaggcggaatgcaagatgaaccg
actgcgggtcctaaggccagtgatgggtacgtcaaagagatggttagcatcacaaaggcg
caaccagcatttcaaccggggtcaacgccaatggtaaacaaaaaatgtttcatggcgtac
aaccttataggtgtgattgaagccacagatcaggatacctatcaaattatcaatgtcgaa
ttttttgatcactccactcgcaaaaattttcatttcacggatcacttcaaacataatctc
ggctacctcggtgaaagaggtgcggtttttgcatgtccgccggagggtgaacatcccgct
caggtcctcttcagaccttacggtaatatgtcgacaccacgaaaggagtggacgtatcag
ctcaaacgcaaagattcacgtatcttgggtgtggcggccggtggtttatcaccctcttcc
agtttacgtgagacaacggatagtgatttgcaaggatatggtgacgtcgcagttgccacc
agtgagggtgatctgaccttcctcaccggaaccgggagagagcgtaggattatgggtttg
ggtggtgactttgtttcgatggtggctagctcggaatggctgtttgttgtgtatagagca
ggatcgacgacaattgatggatcgcaaaatttgtcgtattgtatcatcaattttgatgat
ttcagtgtaaggcagagaggtatcttgccactgcctaaaggtcatacattgaaatggata
ggattgacagatcagaatgcacctgtgacatatgatacgacgggttgtatacatgttttg
actaaattcaggataccacatcatgcttcgtgggcgcgtatccttgatacaaatcttttg
gagcggaagcaaggaaaggatgagtcgtattggcctgttgggatgagtgagaatacgttt
cattgtttgattcttaagggaagacaagaatatcctgcatttccgaaaccgcttatccaa
gaacttccaattatactaccattcaggcgagatgagccaaaagaagaaatgattgaacga
caattgctttatgttcaaacttcattggatctccttgatgaagaacttacaacagaagat
attgtttcgcgagaacgaaatattgataaagaactcatccttctcatacaagcggcgtgt
aaatctgatgatgctcctcgggttatcgagctcgttaaactcttacatctcctaccctca
ttcgatgccgctatcaaaattgccggattctaccatctacttggtcttcaagagaagttg
gaagtgttgaaaagtgagagggaagaggctgaagatcggctagaagtgttgagagagaag
agaaaaagatggttgaagacgacgaaacggaatggtggtgggaggagatatgatccgttg
ggtgatactggtccgccaccgatgattcaaaggcccggaatgtctcgtgtcgagaaacct
attgttgaacgaacaaggttcagctcaattgcaccaacaactcaaactcaaactgttcgt
gatgattcttctatgacgatgacgaggagtccgagtccgagtccttgggacaatgatacg
gaattgggtggtggtgctgtttcgttgaacggtaacgacgattataatacattaggagct
gggggagaggaattgggattcgggactatgacgggtttgggagggacggcacagaagagg
aagaggaatgatgatatggaggatgttggtgtgagtcaagtatcggatgtatctatcatg
cctcctccacctaaacaaaaaacgaacccctttgcacgaaaaaataatacgtccgagtca
aatacgacacgaaatccattctcgttacgcccgaaaccgtctactatcttgaatggtggt
ggtgggattacaggtcgaggatctattcaaaagagtgatagtttctttgataaagtagaa
gctgcagccgataacggcaagaaatcgataaccaagaaatcgagttcgaaatccaccacc
aaagacaaatcatcggcatcggcatcaggtaataatggaccgaaacagacgacgttgttt
gggatgatgccaagagcttttcaaacttcacaagcccctaaaaagccttcagaggagatt
tccaagaaacaaggacacattgatgatggagaggagatgggtgaggagactcaagagttg
ttgggtagttgtccaccagatatagcggatatgggagctagtgagagtcagatgacgttg
atggatagtcgaggattggaagaaacgcagttggatgagactcaggttgattag

DBGET integrated database retrieval system