KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT34901Help
Entry
AGABI1DRAFT34901  CDS       T03136                                 

Gene name
AGABI1DRAFT_34901
Definition
(RefSeq) hypothetical protein
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 18829117
NCBI-ProteinID: XP_007326106
JGI: Agabi_varbur_1_34901
UniProt: K5XH97
LinkDB All DBs
Position
Unknown
AA seq 364 aa AA seqDB search
MHVDTRPSGEEPQPPLRLLQDEPLRLYPTGPSGIRLSDFEVRGTLGTGTFGHVLLVRHKT
ARSDSAQLYAMKVLRKTKIVALHQIEHVKAENYILGRVQHPFVVDLFATFQDGLNIYMLM
SYIPGGELFTHLRRAQRFSPDVTRFYLSTIVLALRYLHSYNIVYRDLKPENLLLDARGYI
RLTDFGFAKVVDDRTWTLCGTPEYLAPEVIQSDGHGKAADWWACGVLCYEMLVGYPPFFD
ETPYGIYEKILVGEVYWPRHLDRLSKDLIRGFLNPDRSKRLGNAGDGIEGVLRHAWFRGV
DWEALERREINAPIIPRSSGEEEAENFLNLPVPAAQDIPGFFQDDATIATQIRNDYLSYH
FPTF
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcatgttgacacccgaccctccggagaagagccccagccaccgcttcgattattacag
gatgaacctttgcgcctatatcccaccggtcctagcggtatccgattgtcagactttgaa
gtccgtggcaccttgggaacagggacgtttggccatgtgctacttgtcaggcataaaacg
gcccgatcggactcggctcaactctacgcaatgaaggttctccgtaagacgaagatcgta
gcacttcatcagattgaacatgtcaaagcggaaaactacatcttgggccgcgttcagcac
cccttcgtcgttgacctctttgcaacctttcaagatggtctcaacatttacatgctgatg
tcatatatacctggtggcgagctttttacccaccttagacgtgcacaaagattcagtcct
gatgtaactcggttttatctctcgacaatagtcctggcactgcgatatctccattcctac
aacatcgtttatcgtgatctcaaaccagaaaacctcctcctcgacgctcgcggctatatt
cgccttactgattttggattcgcaaaagtagtggatgatcgtacctggactctttgtgga
actcctgaataccttgcgcctgaagtgatacaatcagatgggcacgggaaagcagctgat
tggtgggcctgcggtgttctttgctatgagatgcttgtcggctatcctcctttcttcgat
gaaactccatatggcatatacgaaaagatccttgttggcgaggtctattggcctcgtcac
ttagatcgtctatctaaggatctgatccgaggcttcctcaatcctgataggagtaaacgt
ttaggaaatgcgggcgatggcatcgaaggcgtccttcgacacgcgtggttccgtggtgtc
gattgggaggcactagaacgacgtgaaataaatgctccaataattcctcgttcatcaggc
gaagaggaagcagaaaacttcctcaacctgcctgtccctgctgcacaggatatccccggc
ttcttccaagacgatgctaccattgctacacaaattcgcaacgattatctttcctatcac
ttcccaacattctaa

DBGET integrated database retrieval system