KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT54075Help
Entry
AGABI1DRAFT54075  CDS       T03136                                 

Gene name
AGABI1DRAFT_54075
Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00052  Galactose metabolism
abp00500  Starch and sucrose metabolism
abp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AGABI1DRAFT54075 (AGABI1DRAFT_54075)
   00500 Starch and sucrose metabolism
    AGABI1DRAFT54075 (AGABI1DRAFT_54075)
Enzymes [BR:abp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AGABI1DRAFT54075 (AGABI1DRAFT_54075)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18830067
NCBI-ProteinID: XP_007326191
JGI: Agabi_varbur_1_54075
UniProt: K5XIW3
LinkDB All DBs
Position
Unknown
AA seq 882 aa AA seqDB search
MHWTLLTLWLRLVSYICAANVDPAALDACPGYNAQNVKTEGGTLTADLTLAGEACNVFGE
DLVALSLRVDYETKDRIHLKIVDANSSRYEIPDSVFPRPSSQAVSPDSASIQFNFTTSPF
TFSIYRSSSQEVLFSTASHPIIFEPQYLRVKTNLPDNANIYGFGEHTNPFHLPTDNMTLT
LWSRDSFGIPTGTNLYGNHPVYFEHRTTGTHGVFLLNSNGMDVKLSNTAGTSLEYNVIGG
IMDFYFLAGSESDPAEVARQYAEVVGLPAEVAYWTFGLHQCRFGYKDFVDVAGVVSKYAA
AGIPLETMWTDIDYMDRRRIFTVDPQYFPMNRMREIVDFLHSHDQRFILMTDPAVAFIPD
DPDYTPYHRGKDLNIYLKAVNGSDFVALVWPGVTVYPDWFHPNVTEYWTNEFLDFYDPET
GLDIDGAWIDMNEPANFCNLPCDDPFQQAKEQNLPPPRTNPAPDPNAPIFQNDSLSQLRK
RDDILNPPYAINNAAGALSSKTSMTNTVHANGLQEYDAHNLYGSMMSIATRAAMLARRPG
KRTLVITRSTFAGIGAHVGKWLGDNVSLWEHYRFSIAGMLNFATIFQVPMVGSDICGFSG
ETTETLCARWATLGAFYPFMRNHNQDTSPSQEYYIWPLVTQAAKNAIDIRYRLMDYFYTA
FHQAHTDGTPVLHPLWFKYPKDANTFPLDLQFFFGDSILVSPVTEEGSTSVDIYLPDDIF
YNFTSLAPIEGTGSTVSLTNVDFTTIPVHIKGGVVLPLRVESAMTTTELRTKDFEFVVAT
GQDGTASGSLYIDDGESIEQSQMTTVDMSFKEGKLDVKGTFDFPTGVNVARVRFLNVEKA
PKKVKVNGKNLGHSRIEHDATNKVLDVIVDVAFDKDLSVELS
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgcactggactctcctcacattgtggttgaggttggtttcctatatatgcgctgcaaac
gtcgatcctgcagccctagatgcatgccccgggtacaacgcgcagaacgtcaagacggaa
ggaggaacccttacagcggatcttacgcttgccggtgaagcctgcaatgttttcggggag
gatcttgtagcgctttctctgagagttgactatgaaaccaaggatcgtatccatttgaaa
atagtggacgccaactcgagccgttatgaaattcccgacagtgtcttccctcgaccctcc
agccaagcagtgtcgccagactcggcttcaatccaattcaacttcaccacctcaccattt
accttctcaatctatcggagttcctctcaggaggtactattctctaccgcttcgcacccc
atcatctttgagccgcaatatcttcgtgtcaagacgaatctacccgataatgcgaacatt
tatggtttcggggagcacactaatcctttccacctcccaactgacaatatgacactcact
ttatggtctcgggattcctttgggatccccactggtaccaatttatacggaaatcaccca
gtctatttcgaacatcgtaccacgggaacacatggtgtctttttgttgaactccaatggt
atggatgtcaagcttagcaacacagcgggaaccagtctggagtataatgtcatcggtggt
attatggacttctatttcttggctggcagtgagtcggacccggcagaggttgcgagacaa
tatgcggaagtcgtcggtctcccagctgaggtagcgtattggacttttggtcttcatcaa
tgtcgctttggctataaagatttcgtcgacgtggctggcgttgtatctaaatatgcagca
gctggcatacccctagagaccatgtggacggatatcgattatatggatagacgtcggatc
ttcactgtcgacccgcaatacttcccgatgaaccggatgcgtgaaatcgtcgacttttta
cattcccatgaccagcgcttcattttgatgactgatcccgcggtagcgtttataccagat
gatccggattatactccgtatcaccgtggcaaagacctcaacatatacctcaaagctgta
aacggaagtgatttcgttgccctcgtctggcctggtgtgaccgtatatccagattggttc
caccccaatgtcaccgaatattggactaacgaatttcttgacttctacgaccctgaaacg
ggactcgatattgacggtgcatggattgacatgaacgaacctgctaacttctgcaaccta
ccttgtgatgatcctttccaacaagccaaggaacagaatcttcctccgcccaggacaaat
cccgcgcccgatccaaatgcccctatcttccaaaacgattctctgtctcaactaagaaag
cgcgatgatatcctcaatccaccctatgcaatcaataatgctgcgggtgcgctttcgtcc
aagacttccatgaccaatacggttcatgctaatggacttcaggaatacgatgcgcacaat
ctgtacgggtctatgatgtccattgctacacgtgcggccatgcttgcccgtcgtcccggg
aaacgaacccttgttattactcgctctacgtttgctggtatcggagcacacgtcggcaag
tggctaggggataacgttagtctatgggagcattatagattttccattgctgggatgttg
aactttgcgactattttccaagtcccaatggttggaagcgacatttgcggattcagtggt
gaaacaacggaaactttgtgtgctcgatgggccacgcttggcgctttctatcccttcatg
cgcaaccataatcaggacacttctccgagtcaagagtattatatctggcctttggtaact
caggcagccaagaacgcaattgacattcgttatcgcctcatggactacttctacactgct
ttccatcaagcccacaccgatggcacgcccgttctccatcctctctggttcaaatatccg
aaagacgcgaacaccttccctcttgatctccaattcttcttcggcgattcaatccttgta
tctcccgtcacggaagagggctcgacctctgtcgacatataccttcccgacgatatcttc
tacaacttcacttccttggctccaattgagggtaccggatcgaccgtctctctcactaac
gttgatttcacgactatccccgttcacattaagggtggtgtcgtgcttcctcttcgcgtc
gaatctgccatgacgacgacagagttgaggacgaaggacttcgagttcgtcgtagctacc
ggtcaagatggtactgcctccggcagtctttacatcgacgatggagagtctatcgaacag
tctcaaatgactactgtggatatgagcttcaaggagggcaagttggatgtaaagggaaca
tttgatttcccaaccggcgttaatgtagcgcgcgtgcggttccttaacgtggagaaggct
cccaagaaagtgaaggttaatgggaagaatttgggtcactcgcgcatcgagcatgatgcg
acgaacaaggtgttggacgtcattgttgatgttgctttcgataaagatttatcggtggag
ctttcgtaa

DBGET integrated database retrieval system