KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT69426Help
Entry
AGABI1DRAFT69426  CDS       T03136                                 

Gene name
AGABI1DRAFT_69426
Definition
(RefSeq) hypothetical protein
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 18830802
NCBI-ProteinID: XP_007326299
JGI: Agabi_varbur_1_69426
UniProt: K5Y540
LinkDB All DBs
Position
Unknown
AA seq 510 aa AA seqDB search
MSLLNRALDLDWRTLGAGLFGAVLVAYATCKHVEAKRSPLNSIPTIGYSGVLSSYFTALK
WMTHGNELVQEGYDRYPTGIFKIASISRWVVVLTGQKFVDEVRKAPDDVLSFRQAMSDVI
QTKYTMGIALSEDPYHVATVRSPLTRNINVRFDDIKDEIQESWMTYIPPTDDWVSVPAYE
TIMHIVARTSNRYFTGLPLCRDPEYISLQENFTTQVVVAAAVIKVFPDILKPLVGNIMTV
LPGSVKKATGYLEPIINERLVMIEQGVDWENMPNDLITWLLEMAPEHRRTVKDLTLRILT
INFAAIHTSTTTFTQALYDLACHPECVDELRQEAENVIAEHGWTKPAMQRMRKIDSFIKE
SQRMNSIDSLQMHRKVLKDWMLSDGTVIPAGTIVSVANGPMNMEETSFPDSDTFKAFRHS
EKRDGEGELDSIKYQMVALSLDMIVFGHGRHACPGRFFAANEIKAIFTYCLLNYDVQLDG
GSMDRPRNTLAQTSVMPNMKAKVMFRKRAS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgctgaaccgcgctctggatttagattggaggaccctaggagcggggcttttt
ggtgccgtcctggtggcatacgcaacatgcaagcacgtcgaggcgaaaaggtcacccctc
aacagtattcctactatcggatactcgggtgttttaagctcctatttcaccgcactcaaa
tggatgacacatggtaatgaattagttcaagaaggctatgaccgatatcctactggtata
ttcaaaatagcaagcatatccagatgggttgtcgttctcactggccagaaattcgttgac
gaagttcgtaaggctccggatgatgtactttcatttcgacaagctatgagcgatgtaatc
caaaccaaatatactatgggaatagctctctcggaagacccataccacgttgcaactgtt
cgctccccgcttactcgaaatatcaacgttcggtttgatgatatcaaagatgagattcaa
gagtcttggatgacgtatatcccgcctacagatgattgggtttctgttccggcatatgag
accattatgcatatcgttgctcgcacgagtaatcgatattttacagggctgcctttatgt
cgagatccagaatacatctctctacaagagaactttaccactcaagtcgtggtcgctgct
gcagttatcaaggtttttcctgacatccttaaacctttggtaggaaatattatgacagtt
ctgccaggaagtgtgaagaaagccactgggtatcttgaaccaatcatcaacgaaagattg
gtgatgatagaacaaggtgtagattgggaaaacatgcccaatgatcttatcacttggtta
cttgagatggcaccggaacatcgacgaacggtcaaagacttgactcttcgcattcttacc
ataaattttgctgctattcatacaagtacaacgaccttcacacaagctctgtatgatctt
gcgtgccatcccgagtgtgtcgatgaattgcgtcaagaagctgagaatgttattgctgaa
catggatggacgaaacctgcaatgcagcgaatgcgcaagatcgatagttttatcaaggaa
tcccagagaatgaatagtattgatagtcttcagatgcaccgtaaagtccttaaagattgg
atgctgtcggatggaaccgtcataccggcaggaacaatagttagtgttgctaatggtccc
atgaacatggaagagacatcttttcctgatagtgataccttcaaagctttcaggcattcc
gaaaagcgagatggagagggcgaactggatagcatcaagtaccaaatggttgcccttagt
ctcgatatgattgttttcggacatggtcgacatgcttgtcccggacgattcttcgcagcc
aatgagatcaaagccatattcacgtattgtttattgaactatgacgttcaactcgatggt
ggatcaatggataggccgaggaatacgcttgcgcaaacgtcggttatgccgaatatgaaa
gcgaaagtaatgttcaggaaaagggcctcctga

DBGET integrated database retrieval system