KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT71206Help
Entry
AGABI1DRAFT71206  CDS       T03136                                 

Gene name
AGABI1DRAFT_71206
Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp03030  DNA replication
abp03410  Base excision repair
abp03420  Nucleotide excision repair
abp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:abp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AGABI1DRAFT71206 (AGABI1DRAFT_71206)
   03410 Base excision repair
    AGABI1DRAFT71206 (AGABI1DRAFT_71206)
   03420 Nucleotide excision repair
    AGABI1DRAFT71206 (AGABI1DRAFT_71206)
   03430 Mismatch repair
    AGABI1DRAFT71206 (AGABI1DRAFT_71206)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:abp03032]
    AGABI1DRAFT71206 (AGABI1DRAFT_71206)
   03400 DNA repair and recombination proteins [BR:abp03400]
    AGABI1DRAFT71206 (AGABI1DRAFT_71206)
Enzymes [BR:abp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AGABI1DRAFT71206 (AGABI1DRAFT_71206)
    6.5.1.6  DNA ligase (ATP or NAD+)
     AGABI1DRAFT71206 (AGABI1DRAFT_71206)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AGABI1DRAFT71206 (AGABI1DRAFT_71206)
DNA replication proteins [BR:abp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AGABI1DRAFT71206 (AGABI1DRAFT_71206)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AGABI1DRAFT71206 (AGABI1DRAFT_71206)
DNA repair and recombination proteins [BR:abp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AGABI1DRAFT71206 (AGABI1DRAFT_71206)
   NER (nucleotide excision repair)
    Other NER factors
     AGABI1DRAFT71206 (AGABI1DRAFT_71206)
   MMR (mismatch excision repair)
    Other MMR factors
     AGABI1DRAFT71206 (AGABI1DRAFT_71206)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C HHH_5
Motif
Other DBs
NCBI-GeneID: 18830937
NCBI-ProteinID: XP_007328129
JGI: Agabi_varbur_1_71206
UniProt: K5XC96
LinkDB All DBs
Position
Unknown
AA seq 819 aa AA seqDB search
MVKRKLSFDDAKSSPKKRTKHGSQARLDAFFTTSPGKIRATPLETPVETNHGEKIPSLSP
LVIDVDAEDVETQFEERLVPPLAVPQTVRVQKKEVNIPGHSVKFQPLQFAPLDVDPINYS
PDGQPWLEKGAPYAFLTHAFSTLSSTRSRIIIINTLTNCLRTIISKHPESLLPSLYLLSN
TLAPPYAPIELGLGPAIISRAIQNVSGITPATLKKLYNTLGDPGDVAVAAKTNLRTLVPH
PQLTISYVYDSLMMIAHSKGQGAARQKEKLIEKLLLSANGEETRYMTRTLCQNLRVGAVR
TSMLTALARAIALSYESPGLLEGEDTLHNKAGLSDCPRNELNEIFLKAESIVKGVFVKHP
NYGNIVTALLDTGLYGLEEKVPLTIGIPLHPTLGSPMRSLDEVYDRLANQPFVAEFKYDG
QRAQVHAITKDGRLSEFKIFSRHLEDMTSKYPDIQLLVNSLLERSPSISSFVMDAEIVAV
NPRTGAIKTFQELSNRAKKDVQVRDIQVSVCLYAFDLMYLNGESLLQKTFRERRSLLQNS
FSPYTPEEIGFARFTHVESMNSEVGQASVEVFWRRSIESQCEGLMIKLLDNIVVDPEGDK
SNSHMRKKPLPATYEPDKRTAAWLKLKKDYVSGVGDSLDLVPVGAWYGNGRKVKWWSPIL
MAVYDQSSGQFVAVCKCMSGFTDSFYQDTRDRYNPGDGPDVICSPRPLWECDFGGFTPDV
YFRPQEVWEIRGADITLSPVSVAAKGLGSLTRGLSLRFPRFLRVREDKTIEQASTPEFLA
SIWKKQQGSKEGHVEDELVDVDFASSPGVSEDDLSELVA
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaacggaagctttctttcgacgatgccaaatcttcacctaaaaagcggacaaaa
catggaagtcaagcccggctggatgcatttttcaccacgtcaccgggcaaaataagagcg
accccgttggagacgcccgttgagacaaaccatggagaaaagatcccaagcttgtctcct
ctcgttattgatgtcgatgcagaagacgtggagacgcaattcgaagaaaggctggtccct
ccattggcagtcccgcaaacagtgcgagtccaaaaaaaggaggttaacattcctggtcat
tcggttaagtttcagcctctgcagttcgcacctttggatgtcgatcctataaactattcg
cccgatggacagccttggctcgaaaagggtgctccctatgcgtttctcactcatgcattc
tcaaccctctcatctactcgttctcgtatcatcattatcaataccctcacgaactgtttg
cgtacgattatatccaagcatccagaatcgcttcttccttctctttatcttctttccaac
actcttgctcccccgtacgctcctatcgagcttggacttggacctgctattatctcgcgg
gccattcaaaatgtttctggaatcacaccggctacactaaaaaaattgtataatacgcta
ggagatcctggtgatgttgctgttgctgctaaaactaaccttcgaacgctagtgccgcac
cctcaattgaccatctcttacgtgtatgattcactcatgatgattgctcactcaaaaggc
caaggagcggctagacaaaaggaaaagctgattgaaaagcttttgttgtcggccaatggt
gaagaaactcgttacatgacccgtacactatgccagaatcttcgtgtgggggcggtcaga
acttccatgctgactgctttggctcgagctattgccttatcatatgaatcgccgggctta
ctcgagggcgaagataccttacacaacaaggcagggttgtcagactgtccgcggaacgaa
ctgaacgaaatttttttgaaagccgagtccatagtcaaaggtgtattcgtcaaacatcca
aactatggcaacatcgttactgcacttttggacaccggtttatacggattggaggagaaa
gttcctcttacgataggtattccgctccatccgaccttgggctcaccgatgcgttctttg
gatgaagtctatgacaggttggcgaaccagccgttcgtagctgagttcaaatacgacgga
cagagggcgcaagttcatgccataacaaaagacgggcggctttcagagttcaagatattt
tcacgtcatctagaggatatgacaagcaaatatcccgacattcaattgctcgttaattca
ctcttagaaagatcaccttcgatatcctccttcgtcatggatgcagaaatagttgccgtc
aatcctcgaacaggtgctatcaaaacattccaagagttatccaatcgagcgaaaaaggat
gtgcaagtcagagatatccaggtttcagtgtgtttgtatgcattcgacttgatgtaccta
aacggagaatcgcttctacaaaagacgtttcgcgaacgaagatctctactccagaactcc
ttctcaccctatactccggaggaaataggattcgctcgctttactcatgttgaaagtatg
aatagcgaggtgggccaagccagtgtggaggttttctggcggcggtcaatcgaaagtcag
tgtgaaggcctgatgattaaattactcgacaatatcgtggtcgacccagaaggggacaag
tcaaacagtcatatgaggaagaaacctttaccagcaacatatgaacctgataagcgaaca
gcagcatggttgaagttgaagaaagactatgtcagtggagtcggagacagtctcgatctg
gtgccagttggtgcttggtacgggaatggtagaaaagtcaaatggtggagtcctatctta
atggctgtatatgatcagtcaagtggtcaatttgtagccgtctgtaagtgcatgtcaggt
tttacggacagtttttaccaggacacgagagacaggtataatcctggggatgggcctgat
gtaatttgttcacctcggccgctgtgggagtgcgattttggaggttttactccagacgta
tattttcggccgcaggaggtctgggaaatacgaggggcggacatcaccttgagcccagtt
tctgttgctgccaaggggttgggatccttaactcgaggtttaagccttcgctttccacgg
tttctgagagtccgagaagataaaaccattgaacaagcgagcacgcccgaattcttggct
agtatttggaagaagcaacagggaagtaaggaaggacatgttgaagacgaactagtggat
gttgattttgcaagttcccccggtgtatcggaagatgatctatcagagttggtcgcataa

DBGET integrated database retrieval system