KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT77702Help
Entry
AGABI1DRAFT77702  CDS       T03136                                 

Gene name
AGABI1DRAFT_77702
Definition
(RefSeq) hypothetical protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00500  Starch and sucrose metabolism
abp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AGABI1DRAFT77702 (AGABI1DRAFT_77702)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:abp01003]
    AGABI1DRAFT77702 (AGABI1DRAFT_77702)
Enzymes [BR:abp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AGABI1DRAFT77702 (AGABI1DRAFT_77702)
Glycosyltransferases [BR:abp01003]
 Polysaccharide
  Storage polysaccharide
   AGABI1DRAFT77702 (AGABI1DRAFT_77702)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_5 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 18831442
NCBI-ProteinID: XP_007332234
JGI: Agabi_varbur_1_77702
UniProt: K5VS21
LinkDB All DBs
Position
Unknown
AA seq 759 aa AA seqDB search
MAAESKRDVRQPVLFECAWEVANKVGGIYTVIKTKVPVSVSEFGDRYCLIGPLSYKTAPM
EVEPEEPSDPHLAATLQSMQAQGVKALYGRWLIEGNPQVLLFDTSSMYPRLDEWKADLWN
LAGIPSPPNDHETNETIVFGYLVAWFLGDYVSRQLTTAIVAHFHEWQAGLAIPLCRKRHI
DVTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSAAHCADVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVVKFQAMHEFQNLHATAKAKINEFIRGHFYGHY
DFDLDNTIYLFTAGRYEYRNKGVDMFIESLARLNYQLQKAGSTVTVVAFIIMPAATHSYT
IDALKGQAVTKQLRDTVTEIQNRIGQRLFDRAARFTGDMKSIPTADDLISEEDQILLKRR
IFALKRNSLPPVTTHNMADDPNDPILNQIRRVKLFNNAHDRVKIIFHPDFLNSNNPILAL
DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCFMQDLIERPEEEGCY
IVDRRMQSVEDSVNQLADYLYAFTNKTRRQRINQRNRVERLSPLLDWKNLGIEYSKARQL
GLRRAYPDAFEGGEGVVGGGPGGHGGHGGGGRRVGMYASAGSVPASPRMRGAITPGDIGT
LTEDMQGLGTSDYRGYGWADHVDEDDTYPFPLAMKVRSRSGSVRSRSGASTPGGGGVGAF
KSLSEGDLRKANAALKLSQVNGEDEDTGGKNGGEGGSGN
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgaaagcaagcgcgatgtccgacagcccgtcctgttcgaatgtgcgtgggaa
gtcgcgaacaaggtcggggggatctacacggtgatcaagaccaaagtgcccgtctctgtc
tccgagtttggcgaccgatactgcctcatcgggccgctctcctacaagaccgcgccgatg
gaggtcgagccagaggagcccagtgacccccatctcgctgccactctccagtccatgcag
gcccagggcgtcaaggctctctacggtcgctggctcatcgagggcaacccccaggtcctt
ctctttgataccagcagcatgtacccccgcctcgacgagtggaaggccgacctctggaac
ctcgctggtatccccagccctcccaacgaccacgagacaaacgagaccatcgtctttggc
tatctcgtcgcttggttcctgggcgattacgtctcccgccaactgaccaccgccatcgtc
gcccactttcacgaatggcaagccggcctcgccatccccctctgtcgcaaacgtcatatc
gatgtcaccacggtgttcaccacccatgccaccctcttgggccgatatctctgtgctggc
tctgtcgacttttacaacaatctccaatactttgacgtcgaccacgaggccggaaaacgc
ggtatctaccacagatactgcatcgaacgttctgctgcccactgcgccgacgtctttacc
accgtttctcacatcacagcctacgaaagcgagcatctcctcaaacgcaaacccgacggt
gtccttcccaacggtctcaacgtcgtcaaatttcaagccatgcacgaatttcaaaacctt
catgccaccgccaaggccaagatcaacgagtttatccgtggtcatttctatggccactac
gactttgatcttgataataccatctacttgtttactgccggtcgttacgagtacaggaac
aagggcgtggacatgtttattgaatctctcgctcgcctcaactatcagttgcagaaagca
ggctcaacagtcactgtcgtcgcctttatcatcatgcccgccgcgacccactcttatacc
atcgatgctctcaaaggacaagccgtcacaaagcagctccgcgatacagtcaccgaaatc
caaaatcgtatcggtcaacgtttgtttgaccgtgccgcccgtttcactggcgacatgaaa
tccattccaactgcagatgatttgatttcagaagaagatcaaattctactcaagcgacgt
atctttgcgcttaagcgaaactcacttccacctgtcacgacgcacaacatggctgatgat
cccaacgatccgattttaaaccagatccgacgtgtcaagttgttcaacaatgctcatgat
cgtgttaaaatcatctttcatcctgattttctcaatagtaataatccgattttggcattg
gattatgaagagtttgtgaggggatgtcatttgggtgtgtttccgagttattatgaaccg
tgggggtatacacctgcggaatgtactgttatgggaattccgagtattacgaccaacctt
tctggatttgggtgttttatgcaagatcttattgaacgtcctgaagaagaaggctgttac
attgtcgatcgtcgaatgcaatccgtcgaagattcagttaaccaattagccgattatctg
tatgcgtttacaaacaaaactcggcgtcaaaggatcaatcaacgtaatcgagtcgaacgg
ttgtcgccgttgttggattggaagaatttggggattgagtattcaaaggccaggcaattg
gggttgaggagagcttatccggatgcgtttgagggtggggagggtgtggtgggtggtggg
ccggggggacatgggggacatggaggtggggggaggagggtgggtatgtatgctagtgcg
gggagtgtacctgctagtccgaggatgagaggtgcgattaccccaggtgatattgggact
ttgacggaggatatgcaaggtctggggacgagtgattatagagggtatggatgggccgat
cacgtagacgaagatgatacctatcccttccccctcgcaatgaaagtccgttcgagatca
ggttcggtgagaagtcgaagtggggcaagtacacctggtgggggaggggtgggagcgttt
aagagtttgagtgagggggatttgagaaaggcgaatgcggctttgaagttgagtcaggtg
aatggggaggatgaggatacgggtgggaagaatgggggtgaaggtgggagtgggaattga

DBGET integrated database retrieval system