KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT86060Help
Entry
AGABI1DRAFT86060  CDS       T03136                                 

Gene name
AGABI1DRAFT_86060
Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00020  Citrate cycle (TCA cycle)
abp00480  Glutathione metabolism
abp01100  Metabolic pathways
abp01110  Biosynthesis of secondary metabolites
abp01130  Biosynthesis of antibiotics
abp01200  Carbon metabolism
abp01210  2-Oxocarboxylic acid metabolism
abp01230  Biosynthesis of amino acids
abp04146  Peroxisome
Module
abp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGABI1DRAFT86060 (AGABI1DRAFT_86060)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AGABI1DRAFT86060 (AGABI1DRAFT_86060)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AGABI1DRAFT86060 (AGABI1DRAFT_86060)
Enzymes [BR:abp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AGABI1DRAFT86060 (AGABI1DRAFT_86060)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 18832109
NCBI-ProteinID: XP_007331092
JGI: Agabi_varbur_1_86060
UniProt: K5X5H4
LinkDB All DBs
Position
Unknown
AA seq 419 aa AA seqDB search
MSKKIVVKNPVVELDGDEMTRIIWKKIREELILPYLQLDLKYYDLGLEYRDKTNDQVTIE
AAKAIQKYNVGVKCATITPDEARVEEFKLKEMWKSPNGTIRNILGGTVFREPIILQRIPR
PIPGWVKPICIGRHAFGDQYRSTDYVVPGPGKLQLVFTPKDGSQPVSMNVFDFEGPGVAM
SMYNTDESITGFAHASFKMAISKKMPLFMSTKNTILKRYDGRFKDIFQEIYESTYKPQFE
AAGIYYEHRLIDDMVAQAIKSSGGFVWACKNYDGDVQSDILAQGFGSLGMMTSELLTPDG
QIIESEAAHGTVTRHYREWQKGNETSTNPVASIFAWTRGLLHRAKLDKNEPLKQFCLDLE
SACVEVIDKDGVMTKDLAIAIHGVKNVKREHWVITDAYLDAVNAKLRRKLSDRGLGTKL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaagattgtcgtgaagaatcccgttgtggagctggatggcgacgagatgacc
aggatcatctggaaaaagatccgagaagagctcatcctcccgtatcttcaactcgacctc
aagtactatgatctaggcctggaataccgtgacaagacaaacgaccaagttactatcgag
gccgctaaggccattcagaaatataatgttggtgtcaaatgtgcgaccatcactcctgat
gaggcccgtgtagaagagttcaaactgaaggagatgtggaagagtccaaatggaactatt
cgtaacattctcggaggaactgtcttccgagaacctatcatactgcagcgtattccccga
cccatcccaggatgggtgaagcctatctgtatcggtcgtcatgctttcggtgaccagtat
cgctcgacggactacgttgttcctggacctggaaagctccaactggttttcacccctaag
gatggctctcaaccagtttccatgaacgtgttcgatttcgaaggacctggtgttgctatg
agcatgtacaatactgacgaatccatcactggcttcgcgcacgcttctttcaaaatggcc
atttccaagaaaatgcccttgttcatgtctacgaaaaacaccatcctgaagagatatgat
ggtcgcttcaaagacatcttccaggagatttatgaatcaacctacaaacctcaatttgaa
gccgccggtatctattacgaacatcgtttgatcgacgacatggtcgcccaagccattaaa
tcctcgggtggtttcgtttgggcctgcaaaaactacgatggcgacgtccaatccgacatt
ctcgctcagggtttcggttccctcggtatgatgacttcagaactcttgacacccgacggt
caaatcatcgaatccgaagctgctcatggaacagttacaaggcattatcgggaatggcaa
aagggtaatgagacgtcgactaatcctgttgcgtccatttttgcttggacgagagggttg
ttgcatagagcgaagcttgataagaatgagcctttgaaacagttttgtttggatttggag
agtgcttgtgttgaggttattgataaggatggtgtaatgaccaaggatcttgcgattgcg
attcatggagttaagaatgtgaagagggaacactgggttatcacggatgcctacctggac
gccgtcaatgccaagctgcggaggaagctctcagatcgcggtttagggaccaagctttaa

DBGET integrated database retrieval system