KEGG   Azospirillum brasilense Az39: ABAZ39_00145Help
Entry
ABAZ39_00145      CDS       T03288                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:abq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ABAZ39_00145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abq02000]
    ABAZ39_00145
Enzymes [BR:abq01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     ABAZ39_00145
Transporters [BR:abq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    ABAZ39_00145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N Rad17 AAA_15 AAA_16 AAA_22 RsgA_GTPase AAA_29 AAA_30 AAA_24 AAA_23 NACHT AAA_33 AAA_25 NB-ARC AAA_18 AAA AAA_19 AAA_28 Adeno_IVa2 ATPase_2 RNA_helicase HAD_2 Pox_A32
Motif
Other DBs
NCBI-ProteinID: AIB10454
UniProt: A0A060DIH5
LinkDB All DBs
Position
34236..35054
Genome map
AA seq 272 aa AA seqDB search
MSVQTHIPATAMASRPAAGIHGTKMVARDVKVFYGAKQALKGINLEIQENRVMALIGPSG
CGKSTFLRCLNRMNDTIENCRVEGLIALDGEDVYGKSIDAVQLRARVGMVFQKPNPFPKS
IYDNIAYGPRIHGIASHRDEMDEIVQTSLKRAGLWNEVKDRLREPGTGLSGGQQQRLCIA
RAIAVSPEVILMDEPCSALDPIATAHIEELIDELRENYTIVIVTHNMQQAARVSQKTAFF
HLGDMVECDDTEEIFTNPRDERTQGYITGRYG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccagacccacatcccggccacggccatggcttcgcgtcccgccgccggcatc
cacggcaccaagatggtcgcccgcgacgtcaaggtgttctacggggccaaacaggcgctc
aagggcatcaacctggagatccaggaaaaccgcgtgatggcgctgatcggcccgtccggc
tgcggcaagtcgacgttcctgcgctgcctgaaccgcatgaacgacaccatcgagaactgc
cgcgtcgaggggctgatcgcgctcgacggcgaggatgtctacggcaaatccatcgacgcc
gtgcagctccgcgcccgcgtcggcatggtcttccagaagccgaaccccttcccgaagtcg
atctacgacaacatcgcctacggcccgcgcatccacggcatcgccagccaccgcgacgag
atggacgagatcgtccagacctcgctgaagcgcgccggcctgtggaacgaggtgaaggac
cgcctgcgcgagccgggcaccggcctgtccggtggccagcagcagcgcctctgcatcgcc
cgcgccatcgccgtcagccccgaggtgatcctgatggacgagccctgctcggcgctcgac
cccatcgcgaccgcccacatcgaggagctgatcgacgagctgcgcgagaactacacgatc
gtcatcgtcacccacaacatgcagcaggcggcccgcgtctcccagaagaccgccttcttc
catctgggcgacatggtggagtgcgacgacaccgaggaaatcttcaccaacccgcgggac
gagcgcacccagggctacatcaccggccgctacggctga

DBGET integrated database retrieval system