KEGG   Azospirillum brasilense Az39: ABAZ39_07415Help
Entry
ABAZ39_07415      CDS       T03288                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq00061  Fatty acid biosynthesis
abq00780  Biotin metabolism
abq01100  Metabolic pathways
abq01130  Biosynthesis of antibiotics
abq01212  Fatty acid metabolism
Module
abq_M00083  Fatty acid biosynthesis, elongation
abq_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:abq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ABAZ39_07415
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ABAZ39_07415
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ABAZ39_07415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abq01004]
    ABAZ39_07415
Enzymes [BR:abq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ABAZ39_07415
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ABAZ39_07415
Lipid biosynthesis proteins [BR:abq01004]
 Fatty acid synthase
  Component type
   ABAZ39_07415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AIB11828
UniProt: A0A060DLF1
LinkDB All DBs
Position
complement(1518713..1519498)
Genome map
AA seq 261 aa AA seqDB search
MTTIIPAATTLEGKKGLVLGIANDQSIAWGCARAFRALGADLAVSYLNDKAKRFVEPLAQ
QLEAEIFEPVDVTGEGELKAIFEKIEQKWGKLDFALHSIAFAPKDDLHGRVVDCSREGFQ
MAMDVSCHSFIRMARYAEPLMKDGGSLFTMSYFGANRVIDNYGVMGPVKAALEASVRYLA
AELGPKGIRVHAISPGPIKTRAASGIAHFDELMEKAAERAPEQRLVTIEEVGYTTAFLAT
DGAKGITGSTTYVDCGYSIVG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatcatccccgccgccaccactcttgaaggcaagaagggcctcgtgctcggc
atcgccaacgatcagtcgatcgcgtggggctgcgcccgcgccttccgcgctctgggcgcg
gatctcgcggtcagctacctcaacgacaaggcgaagcgcttcgtcgagccgctggcccag
cagctcgaagcggagatcttcgaaccggtggacgtcaccggcgagggtgagctgaaggcc
atcttcgagaagatcgagcagaagtggggcaagctggacttcgcgctgcattccatcgcc
ttcgccccgaaggacgatctgcacggccgcgtcgtcgattgctcgcgcgagggcttccag
atggcgatggacgtgtcctgccactccttcatccgcatggcccgctacgcggagccgctg
atgaaggacggcggttcgctgttcaccatgtcctatttcggcgccaaccgcgtgatcgac
aattacggcgtcatgggtccggtgaaggccgccctggaggccagcgtgcgctatctggcg
gcggaactgggcccgaagggcatccgcgtccacgccatctcccccggcccgatcaagacc
cgcgccgcctccggcatcgcccatttcgacgagttgatggagaaggccgcggagcgcgca
ccggagcagcgcctcgtcaccatcgaagaggtcggctacaccaccgccttcctggcgacc
gacggcgccaagggcatcaccggcagcaccacctatgtggattgcggctattcgatcgtc
ggctga

DBGET integrated database retrieval system