KEGG   Azospirillum brasilense Az39: ABAZ39_11005Help
Entry
ABAZ39_11005      CDS       T03288                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq00500  Starch and sucrose metabolism
abq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ABAZ39_11005
Enzymes [BR:abq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ABAZ39_11005
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     ABAZ39_11005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase MIIP
Motif
Other DBs
NCBI-ProteinID: AIB12514
UniProt: A0A060DNQ6
LinkDB All DBs
Position
complement(2282390..2284078)
Genome map
AA seq 562 aa AA seqDB search
MIKDLWYKNAVIYNLSVGTFMDANGDGIGDFQGLQRRLDYLQGLGVTCLWLGPFQPSPMR
DHGYDVADYYNVDPRYGTLGDFVEFSHACKQRGIRVIIDLVVNHTSDQHPWFQAARQDPD
SPYRDWYVWSDKKPADADQGVVFPGVQKTTWSWDKEARAYYFHRFYEFQPDLNTAHPEVQ
AELLKVMGFWIELGVSGFRMDAVPFVIATKGPEVKKPKQQFDMLRTFREFVQWRCGDAVL
LAEANVLPTVDQEYFGDDGDRMQMVFNFQVNQNLFYALATADTRPLAKALDVTRVPRPST
NQWGLFLRNHDELDLGRLTEAQRKRVFDAFGPDKDMQLYDRGIRRRLAPMLRGDRRWLEL
AYSLLFTLPGTPVLRYGDEIGMGDDLSLPERECARTPMQWSDEPQGGFTKAADPVHPVIS
GGAYGYERINAAHQRRDPSALLNWTERIIRMRKECPEIGWGDFQVLPTGSNAVLAIRYDW
RNNSVLVVHNLDDRPHEVALEVDGTGESPRLVNLLAEDHNDPEEDGRHRLVLEPYGYRWY
RLGGLDYLLRRTEGPVGGAKRS
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggatctctggtacaagaacgcggtcatctacaacctgtcggtcggcaccttc
atggacgccaacggcgacgggatcggcgatttccaagggttgcagcgccggctggactat
ctgcaggggctgggcgtgacctgcctctggctggggccgttccagccgtcgccgatgcgc
gaccacggctacgacgtggccgactattacaacgtcgatccgcgctacggcacgctgggc
gacttcgtggagttcagccacgcctgcaagcagcgcggcatccgcgtcatcatcgacctc
gtggtcaaccacacgtcggaccagcacccctggttccaggcggcgcgccaggacccggac
tccccttaccgggactggtacgtctggtcggacaagaagccggccgacgccgaccagggc
gtcgtctttcccggcgtgcagaagacgacctggagctgggacaaggaggcccgcgcctac
tacttccatcgcttctacgagttccagccggacctgaacaccgcccaccccgaggtgcag
gccgagctgctgaaggtgatgggcttctggatcgagctgggcgtgtcgggcttccgcatg
gacgccgtgcccttcgtcatcgcgaccaaggggcccgaggtcaagaagcccaagcagcag
ttcgacatgctccgcaccttccgggagttcgtgcagtggcggtgcggcgacgccgtgctg
ctggccgaggccaacgtgctgccgaccgtcgatcaggagtatttcggcgacgacggtgac
cgcatgcagatggtcttcaatttccaggtcaaccagaacctgttctacgccttggcgacg
gcggacacgcggccgctggccaaggcgctggacgtcacccgtgtgccgcgccccagcacc
aaccagtggggcctgttcctgcgcaaccacgacgagctggacctcgggcgcctgaccgag
gcgcagcgcaagcgcgtcttcgacgccttcgggccggacaaggacatgcagctctacgac
cgcggcatccggcggcggctggccccgatgctgcgcggcgaccggcgctggctggagctg
gcctacagtctgctgttcacgctgcccggcacgccggtgctgcgctacggcgacgagatc
ggcatgggcgacgacctgtccctgccggagcgcgagtgcgcccgcacccccatgcagtgg
tcggacgagccgcagggtggcttcaccaaggcggccgaccccgtgcacccggtcatcagc
ggcggcgcctacggctatgagcggatcaacgccgcccaccagcgccgcgacccgtcggcc
ctgctgaactggaccgagcgcatcatccgcatgcgcaaggaatgcccggaaatcggctgg
ggcgacttccaggtgctgcccaccggatcgaacgcggtgctggcgatccgctacgactgg
aggaacaactcggtgctcgtcgtccacaacctcgacgaccgtccccacgaggtcgcgctg
gaggtcgatggcacgggggaatcgccgcggctggtcaatctgctggccgaggaccacaac
gaccccgaggaggacgggcggcaccgtctggtgctggagccctacggctaccgctggtac
cggctgggcgggctggactacctgctgcgccggacggaggggccggtgggcggggcgaag
cggtcttga

DBGET integrated database retrieval system