KEGG   Azospirillum brasilense Az39: ABAZ39_12105Help
Entry
ABAZ39_12105      CDS       T03288                                 

Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq00020  Citrate cycle (TCA cycle)
abq00190  Oxidative phosphorylation
abq00650  Butanoate metabolism
abq01100  Metabolic pathways
abq01110  Biosynthesis of secondary metabolites
abq01120  Microbial metabolism in diverse environments
abq01130  Biosynthesis of antibiotics
abq01200  Carbon metabolism
Module
abq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABAZ39_12105
   00650 Butanoate metabolism
    ABAZ39_12105
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ABAZ39_12105
Enzymes [BR:abq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ABAZ39_12105
    1.3.5.4  fumarate reductase (quinol)
     ABAZ39_12105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AIB12717
UniProt: A0A060DIG7
LinkDB All DBs
Position
complement(2519449..2521230)
Genome map
AA seq 593 aa AA seqDB search
MAAYDIIDHSYDVVVVGAGGAGLRATFGMAEKGLKTACITKVFPTRSHTVAAQGGISAAL
GNMSEDDWRFHMYDTVKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTPEGKIYQR
AFGGMTAHYGKQQAYRTCAAADRTGHAILHTLYQQSLKHEAEFFVEYFALDLIMEDGVCK
GVVAWNLDDGTIHRFRAQLVVLATGGYGRAYFSATSAHTCTGDGGGMVLRAGLPLQDMEF
VQFHPTGIYGSGCLITEGVRGEGGYLTNSNGERFMERYAPSAKDLASRDVVSRSMTIEIR
EGRGVGEHKDHIHLHLEHLPPEIIHQRLPGIAETAKIFAGVDVTKEPIPVLPTVHYNMGG
IPTNFRCEVVNPTAEDPDRVVPGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSAAIRA
AEIVEKGKSVSSSAAATDVALERFDRIRNAKGSIKSSELRLEMQRTMQNNCAVFRTGEVL
EEGVKLIDQTFAKKSDMAISDRSLVWNSDLVEAIELDNLLYQAVATLHSAKNRPESRGAH
AREDYPDRDDENWMKHTVIEVSDKGETKIGYRPVHLYTLTDEVQVFPPKARVY
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctacgatattatcgatcattcctatgacgtcgtcgtcgtcggtgccggcggt
gcgggcctgcgcgccaccttcggcatggccgagaagggcctgaagacggcgtgcatcacc
aaggtcttcccgacccgctcgcacaccgtggccgcccagggcggcatctcggcggcgctc
ggcaacatgagcgaggacgactggcgcttccacatgtacgacaccgtcaaggggtcggac
tggctgggcgaccaggacgccatcgagtacatgtgccgcgaggccatcccggcgatcatc
gagctggagcactacggcgtgcccttctcgcgcacgccggaaggcaagatctaccagcgc
gccttcggcggcatgaccgcccattacggcaagcagcaggcctaccgcacctgcgccgcc
gccgaccgcaccggccacgccatcctgcacaccctctaccagcagtcgctgaagcacgag
gcggagttcttcgtcgagtatttcgcgctggacctcatcatggaggacggcgtctgcaag
ggcgtggtggcctggaacctcgacgacggcaccatccaccgcttccgcgcccagctcgtc
gttctggcgacgggcggctacggccgcgcctacttctccgccacctcggcccacacctgc
acgggcgacggcggcggcatggtgctgcgcgccggcctgccgctgcaggacatggagttc
gtgcagttccacccgaccggcatctacggctccggctgcctcatcaccgagggcgtgcgc
ggcgagggcggctacctcaccaactccaacggcgagcgcttcatggagcgttacgcgccg
tcggccaaggacctcgcctcgcgcgacgtggtgtcccgctcgatgaccatcgagatccgc
gagggccgcggcgtcggtgagcataaggaccacatccacctgcacctggagcatctcccg
ccggagatcatccaccagcgcctgcccggcatcgccgagacggccaagatcttcgccggc
gtggacgtcaccaaggaaccgatcccggttctaccgacggtgcactacaacatgggcggc
atccccaccaacttccggtgcgaggtggtcaacccgaccgccgaggacccggatcgcgtt
gtgcccggcctgatggccatcggcgaggcggcctgcgtgtcggtgcacggcgcgaaccgc
ctgggctccaactcgctgctcgacctcgtggtgttcggccgttcggcggccatccgcgcc
gccgagatcgtcgagaagggcaagtcggtgtcgtcgtccgccgccgcgaccgacgtcgcc
ctggagcgcttcgaccgcatccgcaacgccaagggctccatcaagtcgtcggagcttcgc
ctggaaatgcagcggaccatgcagaacaactgcgcggtcttccgcaccggcgaggtgctg
gaggagggcgtcaagctcatcgaccagacctttgcgaagaagagcgacatggcgatcagc
gaccgttcgctggtctggaactccgacctcgtcgaagccatcgagctggacaacctgctg
taccaggcggtcgccacgctccactcggcgaagaaccggccggagagccgcggcgcccac
gcccgcgaggactatccggaccgcgacgacgagaactggatgaagcacaccgtcatcgag
gtgtcggacaagggcgagacgaagatcgggtaccgcccggtccatctctacaccctgacc
gacgaggtgcaggtgttcccgcccaaggcccgcgtctactaa

DBGET integrated database retrieval system