KEGG   Azospirillum brasilense Az39: ABAZ39_12220Help
Entry
ABAZ39_12220      CDS       T03288                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq00020  Citrate cycle (TCA cycle)
abq00310  Lysine degradation
abq00380  Tryptophan metabolism
abq01100  Metabolic pathways
abq01110  Biosynthesis of secondary metabolites
abq01120  Microbial metabolism in diverse environments
abq01130  Biosynthesis of antibiotics
abq01200  Carbon metabolism
Module
abq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABAZ39_12220 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    ABAZ39_12220 (sucA)
   00380 Tryptophan metabolism
    ABAZ39_12220 (sucA)
Enzymes [BR:abq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ABAZ39_12220 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AIB12740
UniProt: A0A060DIX5
LinkDB All DBs
Position
2545265..2548189
Genome map
AA seq 974 aa AA seqDB search
MSANLEKTSFLFGSNAEYVAELYARFLKDPSSVDSSWNGFFRELDDDSRAVLNELNGPSW
SLEEGTLANGALDPIAASLESIGAPAATNGNGGLVAHAQQVYGGISHQQLRAATLDSIRA
LMLIRVYRVRGHMNAHFDPLGLEKREPHPELDPATYGFGPGDMDRPIFLNYSLGLETASL
RQILEILQKTYCGNIGVEFMHIQDPEEKAWIQERIEGGRNHTDFTVNGKRAIYERLIAAE
GFEKFLQLKYTGTKRFGLEGGESMIPALEQILKRGGQLGLKEVVVGMAHRGRLNMLTNFM
GKPFAAVFSEFQGNPSSPQDVQGSGDVKYHLGTSSDRDFNGNIVHLSLTANPSHLEWVNP
VVLGKVRAKQAQRNDLEREQVMGVLIHGDAAFAGQGIVAETLGLSELRGYRTGGTVHFII
NNQIGFTTNPTYSRSGVYCSDMAKMVQAPIFHVNGDDPESVVHISRIAAEFRQKFKRDVV
IDMVCYRRHGHNEGDEPGFTQPLMYKKIRAHGTTRELYGKQLVEENVLTQAESDQMIQDF
MKKLEGEFEAANSFKPNKADWLEGKWSGLEAAKTDDERKGNTGVAIDVLREVGNKLCEYP
KDFAINSKIARQLEAKKKSLETGEGIDWATAEALAYGTLLVEGNGVRLSGQDSGRGTFSH
RHAVMYDQNNENKYIPLNHLRPDQGPFEVHDSPLSEAAVVGFEYGYSLAEPHSLTLWEAQ
FGDFANTAQTIIDQFLSSGESKWLRMSGLVLLLPHGYEGQGPEHSSARPERFLQMSAEDN
WQICNLTTPANLFHAFRRQMRRPFRKPLVLFTPKSLLRHKLCISSLSELAEGTNFRRVLG
ETATDLLPNEQIRRIVVCTGKVYYDLLQERTARGIKDVALVRLEQLYPFPRSALTEEFAR
YPNAEVVWCQEEPENQGYWAFVDRRLEGALTSIEHKASRPSYVGRPASASPATGLLKRHN
QEQAKLLEDALVIR
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctaatctggagaagacctcgttcctgttcggctcgaacgccgaatatgtcgcg
gagttgtacgcgcgcttcctgaaggacccctcctcggtggattcgagctggaacggcttc
ttcagggagctggacgacgactcccgcgccgtcctgaacgagctgaacggcccgtcctgg
agcctggaggagggcacgctcgccaacggcgcgctcgaccccatcgccgcctcgctggaa
agcatcggcgccccggccgcgaccaacggcaacggcggcctcgtcgcccacgcccagcag
gtctatggcggcatcagccaccagcagctgcgcgccgcgacgctcgacagcatccgcgcg
ctgatgctcatccgcgtctaccgcgtgcgcggccacatgaacgcgcatttcgacccgctg
ggtctcgagaagcgcgagccgcacccggaactcgatccggcgacctacggcttcggcccg
ggcgacatggaccgcccgatcttcctgaactattcgctgggcttggagacggcgtcgctg
cgccagatcctggagatcctgcagaagacctactgcgggaacatcggcgtcgagttcatg
cacatccaggaccccgaagagaaggcctggatccaggagcgcatcgagggtgggcgcaac
cacaccgacttcacggtgaacggcaagcgcgccatctacgagcgcctgatcgccgccgag
ggcttcgagaagttcctgcagctcaagtacaccggcaccaagcgcttcggccttgagggc
ggcgagtcgatgatccccgcgctggagcagatcctgaagcgcggcggacagctcggcctc
aaggaggtcgtcgtcggcatggcccaccgcggccggctgaacatgctgaccaacttcatg
ggcaagcccttcgccgcggtcttctcggagttccagggcaacccgtccagcccgcaggac
gtgcagggctcgggcgacgtgaagtaccatctgggcacctcgtcggaccgcgacttcaac
ggcaacatcgtccacctgtcgctgaccgccaacccgtcccacctggaatgggtgaacccg
gtcgtgctgggcaaggtgcgcgccaagcaggcgcagcgcaacgacctggagcgcgagcag
gtcatgggcgtgctgatccacggcgacgccgccttcgccggccagggcatcgtggccgag
acgctgggcctgtcggagctgcgcggctaccgcaccggcggcaccgtgcacttcatcatc
aacaaccagatcggcttcaccacgaacccgacctattcgcggtccggcgtctactgctcg
gacatggcgaagatggtccaggcgccgatcttccacgtcaacggcgacgaccccgagtcc
gtcgtccacatcagccgcatcgccgccgagttccgccagaagttcaagcgggacgtggtg
atcgacatggtctgctaccgccgccacggccacaacgagggcgacgagccgggcttcacc
cagccgctgatgtacaagaagatccgcgcccacgggaccacgcgggagctgtacggcaag
cagctcgtcgaggagaatgtcctcacccaggccgagtccgatcagatgatccaggacttc
atgaagaagctggagggtgagttcgaggccgccaactccttcaagccgaacaaggccgac
tggctggaaggcaagtggtccggcctggaggccgcgaagaccgacgacgagcgcaagggc
aacaccggcgtggcgatcgacgtgctgcgcgaggtcggcaacaagctctgcgagtatccg
aaggacttcgcgatcaactcgaagatcgcccgccagctcgaggccaagaagaagtcgctg
gagaccggcgagggcatcgactgggcgacggcggaagcgctggcctacggcacgctgctg
gtcgagggcaacggcgtccgcctgtcgggccaggactcgggccgcggcaccttctcgcac
cgccacgcggtgatgtacgaccagaacaacgagaacaagtacatcccgctgaaccacctg
cgccccgaccagggcccgttcgaggtccatgacagcccgctgtccgaggcggccgtggtc
ggcttcgaatacggctactcgctggccgagccgcacagcctgaccctgtgggaagcgcag
ttcggcgacttcgccaacaccgcccagaccatcatcgaccagttcctctcgtcgggcgag
tcgaagtggctgcgcatgtccggcctcgtgctgctgctgccgcacggctacgagggccag
ggtccggagcactcctcggcccgtccggagcgcttcctgcagatgtccgccgaggacaac
tggcagatctgcaacctgacgaccccggcgaacctgttccacgccttccgccgccagatg
cgccggcccttccgcaagccgctggtgctgttcacgccgaagtcgctgctgcgccacaag
ctgtgcatctccagcctgtcggagctggccgagggcacgaacttccgccgcgtgctcggc
gagacggcgacggacctgctgccgaacgagcagatccgccgtatcgtggtctgcaccggc
aaggtctattacgacctgctgcaggagcgcaccgcgcgcggcatcaaggacgtggcgctg
gtccggctggagcagctctacccgttcccccgctccgccctgaccgaggagttcgcccgc
tacccgaacgccgaggtggtgtggtgccaggaggagccggagaaccagggctattgggcc
ttcgtcgaccgccgtctggaaggcgccctcacctcgatcgagcacaaggcctcgcgcccc
agctacgtcggccgtccggcctccgcgtcgccggccaccggcctgctcaagcgtcacaac
caggagcaggcgaagcttctggaagacgcgctcgtcatccgctga

DBGET integrated database retrieval system