KEGG   Azospirillum brasilense Az39: ABAZ39_12585Help
Entry
ABAZ39_12585      CDS       T03288                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:abq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ABAZ39_12585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abq02000]
    ABAZ39_12585
Enzymes [BR:abq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ABAZ39_12585
Transporters [BR:abq02000]
 Other Transporters
  Pores ion channels [TC:1]
   ABAZ39_12585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N GST_N_2 GST_N_3 GST_C_6 DUF1958
Motif
Other DBs
NCBI-ProteinID: AIB12811
UniProt: A0A060DF55
LinkDB All DBs
Position
complement(2623453..2624058)
Genome map
AA seq 201 aa AA seqDB search
MKLYLKPGACSLSPHIVLRESGLAFDVAAVDLVAKKLEDGSDFLAVNPKGQVPTLAFDDG
AVLTEGAAIVQCIADRVPESGLLPAVGTMERYRVLEWLNFIGTELHKTFSPLFRPTTPDA
FKDIVKQTLTAKFAVVEAGLAGKDYLTGDRFTVADAYCFTVLRWAPRVGLPLDGCPNITA
YMARVAARPAVAAALAAEGIA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctacctgaagccgggcgcctgctcgctgtcgccgcacatcgtcctgcgcgaa
agcggcctggccttcgacgtcgcggccgtcgacctcgtcgccaagaaactggaggacggc
agcgatttcctggccgtcaacccgaagggccaagtgccgacgctggccttcgacgacggc
gccgtcctgaccgagggcgccgccatcgttcagtgcatcgccgaccgtgtgccggagagc
ggtctgctgccggccgtcgggacgatggagcgctaccgcgtgctggagtggctgaacttc
atcgggacggagctgcacaagaccttcagcccgctgttccgcccgaccacgccggacgcc
ttcaaggacatcgtcaagcagacgctgaccgccaagttcgcggtggtggaggccgggctg
gccggcaaggattacctgacgggcgaccgcttcacggtggctgacgcctattgctttacg
gtgctgcgttgggcgccgcgggtcggcctgccgctggacggttgcccgaacatcaccgcc
tacatggcccgcgtcgccgcgcgcccggcggtggctgcggcgctggcggccgaagggatc
gcctga

DBGET integrated database retrieval system