KEGG   Azospirillum brasilense Az39: ABAZ39_19110Help
Entry
ABAZ39_19110      CDS       T03288                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
abq  Azospirillum brasilense Az39
Brite
KEGG Orthology (KO) [BR:abq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ABAZ39_19110
Enzymes [BR:abq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ABAZ39_19110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 AlaDh_PNT_C HI0933_like FAD_binding_3 DAO Glutaredoxin NAD_binding_7 NAD_binding_8 Thi4 FMO-like K_oxygenase DUF3467
Motif
Other DBs
NCBI-ProteinID: AIB14037
UniProt: A0A060DMC5
LinkDB All DBs
Position
AbAZ39_p1:complement(999273..1000853)
Genome map
AA seq 526 aa AA seqDB search
MLDSNVKGQLKAYFDKITQPIELAASLDDGAKSQDMQALLQDIASLSDKITFVRTDDDAR
KPSFAIKRTGTDIGVRFAGLPMGHEFNSLILALLQVGGHPSKESAEVIEQVKALEGEYRF
ETYFSLSCQNCPDVVQALNLMSVLNPRIKHVAIDGALFQQEVDSRKIMAVPSIFLNGEPF
GQGRMGLEQILAKIDTGASQRDAEKIKAKDAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVSHTEGPKLATALEQHVKEYEVDVMNLQRAEKLIPAEGPGG
LIEVQLANGASLKSKTVILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRVSVI
GGGNSGVEAAIDLAGIVAEVTLIEFDSQLRADEVLQRKLRSLPNVRVITSGLTTEVHGDG
TKVTGLSYKNRNTGEVHRIDLEGIFVQIGLVPNTEWLKGSVALSPRGEIEVDARGQTSIP
GVFAAGDATTVPYKQIIIAMGEGSKAALSAFDYLIRMAPVEAVAAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgttggatagcaacgtcaaaggccagctcaaggcctatttcgacaagatcacgcagccc
atcgaactggccgcctccctggacgacggcgccaagtcgcaggacatgcaggctctgctg
caggacatcgcgtccctgtcggacaagatcaccttcgtccgcaccgacgacgacgcgcgc
aagccctcctttgcgatcaagcgcaccggcaccgacatcggcgtccgcttcgccggcctg
ccgatgggccacgaattcaattccctcatcctcgccctgctgcaggtcggcggccacccc
tccaaggagtcggcggaggtcatcgagcaggtgaaggcgctggagggtgagtaccgcttc
gagacctacttctcgctgtcctgccagaactgccccgacgtggtgcaggccctgaacctg
atgagcgttctgaacccgcggatcaagcatgtcgccatcgacggcgcgctgttccagcag
gaggtcgactcgcgcaagatcatggccgtcccgtccatcttcctgaatggcgagccgttc
ggccagggccgcatggggctggagcagatcctcgccaagatcgacaccggcgcctcgcag
cgcgacgcggagaagatcaaggccaaggacgccttcgacgtgctggtgatcggcggcggc
ccggccggcgccgcggcggcgatctacgcggcccgcaagggcatccgcaccggcgtcgcg
gcggagcgtttcggcggtcaggtgctcgacaccatggccatcgagaacttcatctccgtc
tcccacaccgagggtccgaagctggccaccgcgctggagcagcacgtcaaggagtatgag
gtcgacgtgatgaacctgcagcgggcggagaagctgatccccgccgagggaccgggcggc
ctgatcgaggtccagctcgccaacggcgcctcgctgaagtcgaagacggtgattctgtcc
accggtgcccgctggcgccagatgggtgtccccggcgaggacgagtaccgcaacaagggc
gtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcgcgtgtcggtcatc
ggcggtggcaactccggcgtggaagcggccatcgatctggccggcatcgtcgccgaggtg
acgctgatcgagttcgacagccagctccgcgccgacgaggtgctccagcgcaagctgcgc
agcctgcccaacgtgcgcgtcatcacctcgggtctgacgaccgaggtgcatggcgacggc
accaaggtgaccggcctcagctacaagaaccgcaacaccggcgaggtgcaccggatcgat
ctggaaggcatcttcgtgcagatcggcctcgtgcccaacaccgagtggctgaagggctct
gtggcgctgagcccgcgcggtgagatcgaggtggacgcccgcggccagacctccatcccc
ggcgtcttcgccgcgggcgacgcgacgacggtgccctacaagcagatcatcatcgccatg
ggcgagggctcgaaggccgccctgtcggccttcgactacctgatccgcatggcgccggtc
gaggccgtcgcggcggcgtaa

DBGET integrated database retrieval system