KEGG   Azospirillum brasilense Az39: ABAZ39_20455Help
Entry
ABAZ39_20455      CDS       T03288                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq00250  Alanine, aspartate and glutamate metabolism
abq00280  Valine, leucine and isoleucine degradation
abq00410  beta-Alanine metabolism
abq00640  Propanoate metabolism
abq00650  Butanoate metabolism
abq01100  Metabolic pathways
abq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABAZ39_20455
   00650 Butanoate metabolism
    ABAZ39_20455
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ABAZ39_20455
   00280 Valine, leucine and isoleucine degradation
    ABAZ39_20455
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABAZ39_20455
Enzymes [BR:abq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ABAZ39_20455
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ABAZ39_20455
Amino acid related enzymes [BR:abq01007]
 Aminotransferase (transaminase)
  Class III
   ABAZ39_20455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIB14295
UniProt: A0A060DNG4
LinkDB All DBs
Position
AbAZ39_p1:1287353..1288639
Genome map
AA seq 428 aa AA seqDB search
MSNQSFQDRRNAAVPRGLANAMPVYVDRAENAELWDVEGNRFIDFAGGIAVLNTGHRHPK
IIEAVKAQLDRFTHTCAMVTPYESFVTLAERLNALVPGSTPKKTAFFTTGAEAVENAVKI
ARAHTGRPGVIAFSGAFHGRTLLAMALTGKVVPYKVGFGPFPAEVYHAPFPNAYRGVSVQ
DSLKALEQLFKSDVDATRVAAIIVEPVQGEGGFNIAPPEFLQALRKICDDNGILLIIDEI
QTGFARTGKMFAIEHSGVEPDLMTMAKSLAGGFPLSAVTGKAEIMDAPIPGGIGGTYAGS
PLATTAALAVLDVIEEEKLIQRSNDLGERIAGRFRTMAQRNTLSVIGDVRNLGGMIAMEL
VKDRGTKEPAPELTKALVAKAAEKGLVLLSCGTYGNVIRILVPLTASDALVDEGLDIIER
SLEELVSA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccagtccttccaggatcgtcgcaacgccgccgttccgcgcggcctcgccaac
gccatgccggtctatgtcgaccgcgccgagaacgccgagctgtgggacgtcgagggcaac
cgcttcatcgacttcgcgggcggcatcgcggtgctgaacaccggccaccgccatccgaag
atcatcgaggcggtgaaggcccagctcgaccgcttcacccacacctgcgcgatggtcacg
ccctacgagtccttcgtgaccctggcggagcggctgaacgcgctggttccgggctccacg
ccgaagaagaccgccttcttcaccacgggtgcggaagccgtcgagaacgccgtgaagatc
gcccgcgcccacacgggccgtccgggcgtgatcgccttctccggcgccttccacggccgc
acgctgctggcgatggcgctgaccggcaaggtcgtgccctacaaggtcggcttcggcccc
ttcccggccgaggtctaccacgcgcccttccccaacgcctaccgcggggtcagcgtccag
gacagcctgaaggcgctggagcagctgttcaagtcggacgtggacgccacccgcgtcgcc
gcgatcatcgtggagccggtgcagggtgagggcggcttcaacatcgccccgccggagttc
ctgcaggccctgcgcaagatctgcgacgacaacggcatcctgctgatcatcgacgagatc
cagaccggcttcgcccgcaccggcaagatgttcgccatcgaacattccggcgtcgagccc
gacctgatgaccatggcgaagagcctggccggcggcttcccgctgtcggcggtcaccggc
aaggcggagatcatggacgccccgatccccggcggcatcggcggcacctacgccggcagc
ccgctggcgaccaccgcggcgctggccgtgctggacgtcattgaggaggagaagctgatc
cagcgctccaacgacctgggcgagcgcatcgccggccgcttccgcaccatggcccagcgc
aatacgctgtcggtgatcggcgacgtgcgcaacctgggcggcatgatcgccatggagctg
gtgaaggaccgcggcaccaaggagccggcgccggagctgaccaaggcgctggtcgccaag
gcggcggaaaagggcctcgtcctgctgtcctgcggcacctacggcaacgttatccgcatc
ctggttccgctgaccgcgtcggacgcgctggtggacgagggcttggacatcatcgagcgc
tccctggaggagctggtttcggcctga

DBGET integrated database retrieval system