KEGG   Azospirillum brasilense Az39: ABAZ39_23690Help
Entry
ABAZ39_23690      CDS       T03288                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq00630  Glyoxylate and dicarboxylate metabolism
abq00710  Carbon fixation in photosynthetic organisms
abq01100  Metabolic pathways
abq01120  Microbial metabolism in diverse environments
abq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abq00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ABAZ39_23690
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ABAZ39_23690
Enzymes [BR:abq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ABAZ39_23690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AIB14898
UniProt: A0A060DUV2
LinkDB All DBs
Position
AbAZ39_p2:complement(128911..130182)
Genome map
AA seq 423 aa AA seqDB search
MHSDRFEATYLIETPLDPAKVAEVMAGEQSCGTFTRVHGETDDLRARARAVVERVEELEP
VASPSLPNTWLERQKRPGPWRRARITISFPTGNVGANLPTLAATVAGNLFDLGEVTGLRL
DSVRLPAAYRNRFDAPRHGVAGTRRLTGVERGALVGSIIKPNLGLSAEETGELVGTLCAA
GLDFIKDDEICADPIHAPLAQRVPAVMDRVRRHQDRTGKHVMVAFNISDETDAMRRHADL
VEREGGSCVMVSLNWCGFSAVQTLRRHSGLVLHGHRNGFGALSRHPSLGIGFDAYQTLWR
LAGVDHMHVHGLQGKFAQPDAEVIDGAKSCLAPLAEGCDDAVMPAFSSGQWAGTVPVTWD
AMGTDDLLFMSGGGIMAHPDGPAAGVTSIRQAWTAVREGVTLPDAAATRPELKRALEFFG
APK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcactccgaccgcttcgaggcgacctacctgatcgaaaccccgctggaccccgccaag
gtggcggaggtcatggcgggggagcagtcctgcggcaccttcacccgcgtccacggcgag
acggacgacctgcgcgcccgcgcccgcgccgtggtggagcgggtggaggagttggaaccc
gtcgcctcccccagcctgccgaacacgtggctggagcggcagaagcggcccggaccgtgg
cggcgcgcccgcatcaccatcagcttccccaccggcaacgtcggcgccaacctgccgacg
ctggccgcgacggtggccggcaacctgttcgacctcggcgaggttaccggcctgcggctc
gactccgtccgcctccccgccgcgtaccgcaatcgcttcgacgcgccgcggcacggcgtg
gccggcacgcggcggctgaccggggtggagcgcggggcgctggtcggctccatcatcaag
ccgaacctcggcttgtcggcggaagagaccggcgaactggtcggcacgctctgcgccgcc
gggctggacttcatcaaggacgacgagatctgcgccgatccgatccacgccccgctggcc
cagcgcgtgccggcggtgatggaccgggtgcgccgccaccaggaccgcaccggcaagcac
gtcatggtcgccttcaacatcagcgacgagacggacgccatgcgccgccatgccgatctg
gtggagcgcgagggcggaagctgcgtgatggtcagcctgaactggtgcggcttctccgcc
gtgcagacgctgcgccgccacagcgggctggtgctgcacgggcaccgcaacggcttcggc
gccctgtcgcgtcaccccagcctgggcatcggcttcgacgcctaccagacgctgtggcgg
ctcgccggggtggaccacatgcacgtccacggccttcagggcaagttcgcccagcccgac
gccgaggtgatcgacggcgccaagtcctgcctcgccccgctggccgagggctgcgacgac
gcggtgatgccggccttctcctccggccagtgggcggggaccgtccccgtcacctgggat
gcgatggggacggacgacctgctgttcatgtccggcggcggcatcatggcccacccggac
ggccccgccgccggcgtgacgagcatccgccaagcctggaccgcggtgcgcgagggcgtc
accctgcccgacgccgccgcgacccggccggagctgaagcgcgccctggagttcttcgga
gcgcccaaatga

DBGET integrated database retrieval system