KEGG   Azospirillum brasilense Az39: ABAZ39_28240
Entry
ABAZ39_28240      CDS       T03288                                 

Definition
(GenBank) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq00052  Galactose metabolism
abq00500  Starch and sucrose metabolism
abq01100  Metabolic pathways
abq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ABAZ39_28240
   00500 Starch and sucrose metabolism
    ABAZ39_28240
Enzymes [BR:abq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     ABAZ39_28240
SSDB
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF4968
Other DBs
NCBI-ProteinID: AIB15756
UniProt: A0A060DPF7
LinkDB
Position
AbAZ39_p3:complement(304871..307249)
AA seq 792 aa
MRTLTGASLVAPALSRDGAQADPQGIAFDLDRGYRLTLFPLGPALARVLIERPGGLRTPR
TWSLAPELSGETDPALADPIDGRDRRDLTGFPGTPAAVEESADCVTVTTPGWRVVVQRSP
LALRWYEPAAEGDGWRLVLADRPTQPYLFDDRSPRFAHHLVSHAGERYHGFGDKSGGTDK
RGRRLAMGTTDALGYDAETSDPLYKHIPFCLSVRPERGGAAVGVFYDNLSRGLFDLGQTI
DAYHGDFIRFEVSDGDLDCYVLFGPSVPQVVANFTALTGRTSFRPRWAISYSGSTMQYTD
APDAGVRLLGFLDALKEHDLPCGSFQMSSGYTMIGDKRYVFHWNRDKFPEPEAVTAKFAE
AGVHLVANIKPALLDDHPKFAEVQGFGGFVRDSDAPDRPQITQFWGGDGAYLDFTNPATT
RWWMGNVTRELLERGIGSTWNDNNEFEIWDDAAVCDVNGHGGTMATLRPVQTHLMIRASH
LAQVAHAPDKRPYLISRSGGPGLQRYVQTWSGDNRTSWKTLRWNLRMGHGFSLSGLFDYG
HDVGGFAGPRPEPELLMRWIEQAVWWPRFTIHSWNDDGSVTEPWTYPELLPQVKAALDWR
ERLVPLLYTLLWRAHRDHDPVMRPLFFDFPDQPEAYGEEDSTMVGDRLLVAPVLDPGRTE
LEVWLPAVPGGWYDLRDGKRYDGGGRVTVAAPLGVAPAFVRAGTLLPLGPAPSWAEGPLT
IRCFPGPEGYAPLTLFDDDGESVCRDESVCLLTISGTDAALLSVSRSGGRAPRWTSLSIE
TADGTPVGTLPL
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgcgcacgctgaccggcgcctccctcgttgcgcccgccctgtcccgcgacggggcgcaa
gccgacccccaagggatcgccttcgacctcgaccgcggctaccgcctgaccctgttcccg
ctggggcccgcgctggcgcgcgtcctcatcgagcggccgggcgggctgcgcacgccgcgc
acctggtcgctggcgcccgagctgtcgggcgagaccgaccccgcgctggccgaccccatc
gacgggcgcgaccgccgcgacctgaccggcttccccggcacgccggcggcggtcgaggag
agcgccgactgcgtcaccgtcaccacccccggctggcgcgtcgtggtccagcgctcgccc
ctggcgctgcgctggtacgagccggcggcggagggcgacggctggcgcctcgtcctcgcc
gaccggccgacccagccctacctgttcgacgaccgctccccccgcttcgcccaccatctg
gtcagccacgccggggagcgctaccacggcttcggcgacaagagcggcggcaccgacaag
cgcggccggcgcctcgccatggggacgaccgacgcgctcggctacgacgcggagacgagc
gacccgctctacaagcacatccccttctgcctcagcgtgcggccggagcgcggcggggcg
gcggtcggcgtcttctacgacaacctgtcgcgcggtctcttcgacctcggccagaccatt
gacgcctaccacggcgacttcatccggttcgaggtgtcggacggcgacctcgactgctac
gtcctgttcggcccgagcgttccgcaggtcgtggcgaatttcaccgccctgaccggacgc
acctccttccggccgcgctgggcgatcagctattccggctcgaccatgcagtacaccgac
gcgccggacgccggggtgcggctgctcggattcctcgacgcgctgaaggagcacgatctg
ccctgcggctcgttccagatgtcgtccggctacacgatgatcggcgacaagcgctacgtc
ttccactggaaccgcgacaagttccccgagccggaggcggtgaccgccaagttcgccgag
gccggcgtccatctcgtcgccaacatcaagccggcgctgctcgacgaccatccgaaattc
gccgaggtccagggcttcggcggcttcgtgcgcgacagcgacgccccggaccgcccgcag
atcacccagttctggggcggcgacggcgcctatctcgacttcaccaaccccgcgaccacg
cgctggtggatgggcaacgtcacgcgggagctgctggagcgcggcatcggctcgacctgg
aacgacaacaacgagtttgagatctgggacgacgcggcggtctgcgacgtcaacggccat
ggcggcacgatggcgacgctgcgcccggtgcagacgcatctgatgatccgcgcctcgcac
cttgcccaggtggcgcacgcgccggacaagcgcccctacctgatctcgcgctccggcggg
ccgggcctccagcgctacgtgcagacctggtcgggcgacaaccggacgagctggaagacg
ctgcgctggaacctgcgcatgggccacggcttcagcctgtcgggcctgttcgactacggc
cacgatgtcggcggcttcgccggtccccgtccggagccggagctgctgatgcgctggatc
gagcaggcggtgtggtggccgcgcttcaccatccattcctggaacgacgacggcagcgtc
accgagccctggacctatccggagctgctgccgcaggtgaaggccgcgctggactggcgg
gagcggctggtgccgctgctctacacgctgctgtggcgggcgcaccgcgaccatgacccg
gtgatgcggccgctgttcttcgacttccccgaccagcccgaggcttatggtgaggaggac
agcaccatggtcggtgaccggctgctggtcgccccggtcctcgaccccggccggacggaa
ctggaggtctggctgccggcggtgcccggcggctggtacgacctgcgcgacggcaagcgt
tacgacggcggcgggcgcgtcaccgtggcggcgccgctgggcgtggccccggccttcgtg
cgggccggcacgctgctgccgctcggccccgccccctcctgggcggaaggcccgctgacc
atccgctgcttccccggcccggagggctacgccccgctgaccctgttcgacgacgacggg
gagagcgtgtgccgcgacgagtccgtctgtctgctgaccatcagcggcacggacgcggcc
ttgctgtcggtgagccgcagcggcggccgggcgccgcgctggacctccctgtccatcgag
acggcggacggcacgccggtcggcaccctgcccctctga

DBGET integrated database retrieval system