KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_00678Help
Entry
ABTJ_00678        CDS       T02045                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
abr00970  Aminoacyl-tRNA biosynthesis
abr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ABTJ_00678
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:abr03029]
    ABTJ_00678
Enzymes [BR:abr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ABTJ_00678
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ABTJ_00678
Mitochondrial biogenesis [BR:abr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ABTJ_00678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AFI94312
UniProt: A0A454ASR0
LinkDB All DBs
Position
complement(689878..691347)
Genome map
AA seq 489 aa AA seqDB search
MAEAQKLKLIDGWEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPV
LNEKVVELAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQLE
DGTTKRIGVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYI
KAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEI
ERQMEILEWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPDEQIEAI
KATMPELPAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKIAANWVM
GEFSGALNKAGLELTDSPVSAEQLGGMIARIIDNTISGKIAKQVFGFMWESEGKSADDII
AEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQV
NELMKKLIG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagctcaaaagttgaaattgattgacggttgggaagtcgttattggtattgag
attcatactcagcttgcaaccaattctaaaattttctcaggttcatcaactgaatttggt
caagacccaaatacacaagcgagccttgtagacttggcgatgccgggtgtattgccggtt
ttaaatgaaaaagtggttgaactcgcaattcgttttggtttagggattgatgcttacatc
gaccaagcttcagtatttgcacgtaaaaactacttctatcctgactctccaaaaggctat
caaattagccaaatggacaatccgattgtgggcttgggccatatcgacattcagcttgaa
gatggtacgactaaacgcattggcgtaactcgtgctcaccttgaagaagatgcgggtaag
tctgtgcacgaccaatttgaaggtatgtctggcattgacttaaaccgtgctggtacgcct
ttgcttgaaatcgtttctgaaccagacatgcgttcggttgaagaagcagttgcctacatc
aaagcaattcacacactagtacgttggttaggtatttctgacggcaacatggctgaaggt
tcattccgtgcggattgtaacgtgtctttacgtcgtccaggacaaccgtttggcacacgc
tgtgagcttaaaaacctcaactcattccgtttcattgagcaagcgatcaatgttgaaatt
gaacgccaaatggaaattttggaatggggcggcgaaattgatcaagaaacccgtttgttc
gatccaaataaaatggaaacgcgttctatgcgttctaaagaagaagcaaatgactaccgc
tacttccctgatccagacttgctaccagtaattattccagatgagcaaattgaggccatc
aaagcaactatgcctgagttgccagcagcacgccgtgcacgctttattgcagactttggc
gtaactgaatacgacgcacacgtacttacgctctcacgcgaaatggcggacttctatgaa
gctgttgttgctgcggctggcggtgcgaagcaaggtaaaattgctgcaaactgggtaatg
ggtgaattctctggtgctttaaacaaagcgggcttagagttaacagactcacctgtttct
gctgaacagcttggcggcatgattgcgcgtattatcgacaacaccattagcggtaaaatt
gctaaacaagtctttggctttatgtgggaatctgaaggtaaatctgccgatgacattatt
gcggaaaaaggcttaaagcaagaaaccgatactggtgcaattgaagcaatcattaaagaa
gtacttgcagccaatgaaaaaatggttgaagagtacaagtctggtaaagaaaaagccttt
aacggtcttgttggtcaagtcatgaaagcatctaagggtaaagctaatcctgcgcaagtc
aatgaattaatgaaaaaattgattggttga

DBGET integrated database retrieval system